🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CDK18

DescripciónCyclin-dependent kinase 18

Gene and Protein Information

Gene ID5129
Uniprot Accession IDs Q07002 Q5VXQ2 Q6V3A2 Q6V3A3 Q96F90
Ensembl ID ENSP00000423665
Symbol PCTAIRE3 PCTK3 PCTK3 PCTAIRE PCTAIRE3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque100430417CDK18cyclin dependent kinase 189544Inparanoid, OMA, EggNOG
Mouse18557Cdk18cyclin-dependent kinase 1810090MGI:97518Inparanoid, OMA, EggNOG
Rat289019Cdk18cyclin-dependent kinase 1810116RGD:1309523Inparanoid, OMA, EggNOG
Dog488573CDK18cyclin dependent kinase 189615VGNC:39049Inparanoid, OMA, EggNOG
Horse100050250CDK18cyclin dependent kinase 189796VGNC:16344Inparanoid, OMA, EggNOG
Cow534048CDK18cyclin dependent kinase 189913VGNC:27121OMA, EggNOG
Opossum100014165CDK18cyclin dependent kinase 1813616Inparanoid, OMA, EggNOG
Chicken771736CDK18cyclin dependent kinase 189031CGNC:437OMA, EggNOG
Anole lizard100564067cdk18cyclin dependent kinase 1828377Inparanoid, OMA, EggNOG
Xenopus448581cdk18cyclin-dependent kinase 188364XB-GENE-489094OMA, EggNOG
Zebrafish100150007si:dkey-166c18.1si:dkey-166c18.17955ZDB-GENE-141215-51OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.