🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

DAB1

DescripciónDisabled homolog 1

Gene and Protein Information

Gene ID1600
Uniprot Accession IDs O75553 A4FU90 B3KTG3 Q4LE59 Q5T6M6 Q5T6M9 Q5T835 Q5T836 Q5T837 Q6NWS9 Q6NWT0 Q6NWT1 Q9NYA8
Ensembl ID ENSP00000360280
Symbol SCA37
Sequence
MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp740508DAB1DAB1, reelin adaptor protein9598VGNC:12998Inparanoid, OMA
Macaque716200DAB1DAB1, reelin adaptor protein9544Inparanoid, OMA
Mouse13131Dab1disabled 110090MGI:108554Inparanoid, OMA
Rat266729Dab1DAB1, reelin adaptor protein10116RGD:628770Inparanoid, OMA
Dog610344DAB1DAB1, reelin adaptor protein9615VGNC:39758Inparanoid, OMA
Horse100049825DAB1DAB1, reelin adaptor protein9796VGNC:16994Inparanoid, OMA
Pig100037307DAB1DAB1, reelin adaptor protein9823Inparanoid, OMA
Opossum100018975DAB1DAB1, reelin adaptor protein13616Inparanoid, OMA
Chicken374083DAB1DAB1, reelin adaptor protein9031CGNC:49036Inparanoid, OMA
Zebrafish692351dab1aDab, reelin signal transducer, homolog 1a (Drosophila)7955ZDB-GENE-060528-1Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.