🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

FOS

DescripciónProto-oncogene c-Fos

Gene and Protein Information

Gene ID2353
Uniprot Accession IDs P01100 A8K4E2 B4DQ65 P18849
Ensembl ID ENSP00000306245
Symbol G0S7 p55 AP-1 C-FOS
FamilyBelongs to the bZIP family. Fos subfamily.
Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse14281FosFBJ osteosarcoma oncogene10090MGI:95574Inparanoid, OMA, EggNOG
Rat314322FosFos proto-oncogene, AP-1 transcription factor subunit10116RGD:2626Inparanoid, OMA, EggNOG
Dog490792FOSFos proto-oncogene, AP-1 transcription factor subunit9615VGNC:40940Inparanoid, OMA, EggNOG
Horse100051632FOSFos proto-oncogene, AP-1 transcription factor subunit9796VGNC:18095Inparanoid, OMA, EggNOG
Cow280795FOSFos proto-oncogene, AP-1 transcription factor subunit9913VGNC:29073Inparanoid, OMA, EggNOG
Pig100144486FOSFos proto-oncogene, AP-1 transcription factor subunit9823Inparanoid, OMA, EggNOG
Opossum100018285FOSFos proto-oncogene, AP-1 transcription factor subunit13616Inparanoid, EggNOG
Platypus100075021FOSFos proto-oncogene, AP-1 transcription factor subunit9258Inparanoid, OMA, EggNOG
Chicken396512FOSFos proto-oncogene, AP-1 transcription factor subunit9031CGNC:49845Inparanoid, OMA
Anole lizard100556427fosFos proto-oncogene, AP-1 transcription factor subunit28377Inparanoid, OMA, EggNOG
Xenopus548954fosFBJ murine osteosarcoma viral oncogene homolog8364XB-GENE-866811Inparanoid, OMA, EggNOG
Zebrafish394198fosabv-fos FBJ murine osteosarcoma viral oncogene homolog Ab7955ZDB-GENE-031222-4OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.