🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

HDAC1

DescripciónHistone deacetylase 1

Gene and Protein Information

Gene ID3065
Uniprot Accession IDs Q13547 Q92534 HD1
Ensembl ID ENSP00000362649
Symbol RPD3L1 HD1 RPD3 KDAC1 GON-10 RPD3L1
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque708441HDAC1histone deacetylase 19544OMA, EggNOG
Mouse433759Hdac1histone deacetylase 110090MGI:108086Inparanoid, OMA
Rat297893Hdac1histone deacetylase 110116RGD:1309799Inparanoid, OMA
Dog487309HDAC1histone deacetylase 19615VGNC:50625Inparanoid, OMA, EggNOG
Horse100070281HDAC1histone deacetylase 19796VGNC:50592Inparanoid, OMA
Cow404126HDAC1histone deacetylase 19913VGNC:49065Inparanoid, OMA, EggNOG
Opossum100032301HDAC1histone deacetylase 113616OMA, EggNOG
PlatypusHDAC1histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC:4852]9258OMA, EggNOG
Chicken373961HDAC1histone deacetylase 19031CGNC:2394Inparanoid, OMA
Anole lizard100554517hdac1histone deacetylase 128377Inparanoid, OMA, EggNOG
Xenopus594953hdac1histone deacetylase 18364XB-GENE-479583Inparanoid, OMA
Zebrafish192302hdac1histone deacetylase 17955ZDB-GENE-020419-32Inparanoid, EggNOG
Fruitfly38565HDAC1Histone deacetylase 17227FBgn0015805Inparanoid, OMA
S.cerevisiae855386RPD3histone deacetylase RPD34932S000005274Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 1
protein    /    hydrolase    /    reductase    /    Histone deacetylase 1
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 1
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.