🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HSPBP1

DescripciónHsp70-binding protein 1

Gene and Protein Information

Gene ID23640
Uniprot Accession IDs Q9NZL4 B3KQP0 B4DG11 O95351 Q6ZNU5 HspBP1
Ensembl ID ENSP00000255631
Symbol HSPBP FES1
Sequence
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456299HSPBP1HSPA (Hsp70) binding protein 19598VGNC:13184OMA, EggNOG
MacaqueHSPBP1HSPA (Hsp70) binding protein 1 [Source:HGNC Symbol;Acc:HGNC:24989]9544OMA, EggNOG
Mouse66245Hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 110090MGI:1913495Inparanoid, OMA, EggNOG
Rat246146Hspbp1HSPA (Hsp70) binding protein 110116RGD:628677Inparanoid, OMA, EggNOG
Dog476381HSPBP1HSPA (Hsp70) binding protein 19615VGNC:53527Inparanoid, OMA, EggNOG
Horse100050496HSPBP1HSPA (Hsp70) binding protein 19796VGNC:51040Inparanoid, OMA, EggNOG
Cow512757HSPBP1HSPA (Hsp70) binding protein 19913Inparanoid, OMA, EggNOG
Pig100518376HSPBP1HSPA (Hsp70) binding protein 19823OMA, EggNOG
Opossum100017290HSPBP1HSPA (Hsp70) binding protein 113616Inparanoid, OMA, EggNOG
Anole lizard100561715hspbp1HSPA (Hsp70) binding protein 128377Inparanoid, OMA, EggNOG
Xenopus548823hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 18364XB-GENE-1007205Inparanoid, OMA, EggNOG
Zebrafish338155hspbp1HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 17955ZDB-GENE-030219-55Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.