🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

AK1

DescripciónAdenylate kinase isoenzyme 1

Gene and Protein Information

Gene ID203
Uniprot Accession IDs P00568 Q9BVK9 Q9UQC7 AK 1
Ensembl ID ENSP00000362271
Symbol HTL-S-58j
FamilyBelongs to the adenylate kinase family. AK1 subfamily.
Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464756AK1adenylate kinase 19598VGNC:13849OMA, EggNOG
Mouse11636Ak1adenylate kinase 110090MGI:87977Inparanoid, OMA, EggNOG
Dog480712AK1adenylate kinase 19615VGNC:37745Inparanoid, OMA, EggNOG
Horse100070413AK1adenylate kinase 19796VGNC:15194Inparanoid, OMA, EggNOG
Cow280715AK1adenylate kinase 19913VGNC:25770Inparanoid, OMA, EggNOG
Pig100521423AK1adenylate kinase 19823Inparanoid, OMA, EggNOG
Opossum100011946AK1adenylate kinase 113616Inparanoid, EggNOG
Chicken396002AK1adenylate kinase 19031CGNC:49598Inparanoid, OMA
Anole lizard100561285ak1adenylate kinase 128377OMA, EggNOG
Zebrafish445486ak1adenylate kinase 17955ZDB-GENE-040822-37Inparanoid, OMA, EggNOG
C. elegans181317F38B2.4Adenylate kinase isoenzyme 16239Inparanoid, OMA, EggNOG
Fruitfly39396Adk1Adenylate kinase 17227FBgn0022709Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.