🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GPR15

DescripciónG-protein coupled receptor 15

Gene and Protein Information

Gene ID2838
Uniprot Accession IDs P49685 Q3MIL4 Q6ISN6
Ensembl ID ENSP00000284311
Symbol BOB
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450102GPR15G protein-coupled receptor 159598VGNC:7971Inparanoid, OMA, EggNOG
Macaque698718GPR15G protein-coupled receptor 159544Inparanoid, OMA, EggNOG
Mouse71223Gpr15G protein-coupled receptor 1510090MGI:1918473Inparanoid, OMA, EggNOG
Rat288181Gpr15G protein-coupled receptor 1510116RGD:1306639Inparanoid, OMA, EggNOG
Dog487947GPR15G protein-coupled receptor 159615VGNC:41404Inparanoid, OMA, EggNOG
Horse100072420GPR15G protein-coupled receptor 159796VGNC:18517Inparanoid, OMA, EggNOG
Cow538740GPR15G protein-coupled receptor 159913VGNC:29557Inparanoid, OMA, EggNOG
Pig100153787GPR15G protein-coupled receptor 159823OMA, EggNOG
Chicken427956GPR15G protein-coupled receptor 159031CGNC:11260Inparanoid, OMA, EggNOG
Anole lizard100567777gpr15G protein-coupled receptor 1528377Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 15

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.