🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

ENTPD2

DescripciónEctonucleoside triphosphate diphosphohydrolase 2

Gene and Protein Information

Gene ID954
Uniprot Accession IDs Q9Y5L3 O15464 Q5SPY6 Q5SPY7 NTPDase 2
Ensembl ID ENSP00000347213
Symbol CD39L1 CD39L1 NTPDase-2
FamilyBelongs to the GDA1/CD39 NTPase family.
Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464883ENTPD2ectonucleoside triphosphate diphosphohydrolase 29598VGNC:13876OMA, EggNOG
Macaque721617ENTPD2ectonucleoside triphosphate diphosphohydrolase 29544Inparanoid, OMA, EggNOG
Mouse12496Entpd2ectonucleoside triphosphate diphosphohydrolase 210090MGI:1096863Inparanoid, OMA, EggNOG
Rat64467Entpd2ectonucleoside triphosphate diphosphohydrolase 210116RGD:69266Inparanoid, OMA, EggNOG
Dog491241ENTPD2ectonucleoside triphosphate diphosphohydrolase 29615VGNC:40381Inparanoid, OMA, EggNOG
Horse100066152ENTPD2ectonucleoside triphosphate diphosphohydrolase 29796VGNC:17596Inparanoid, OMA, EggNOG
Cow100126045ENTPD2ectonucleoside triphosphate diphosphohydrolase 29913VGNC:28509Inparanoid, OMA, EggNOG
Opossum100022598ENTPD2ectonucleoside triphosphate diphosphohydrolase 213616Inparanoid, EggNOG
Anole lizard100561926LOC100561926ectonucleoside triphosphate diphosphohydrolase 228377OMA, EggNOG
Xenopus407961entpd2ectonucleoside triphosphate diphosphohydrolase 28364XB-GENE-5810181Inparanoid, OMA, EggNOG
Zebrafish447905entpd2a.1ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 17955ZDB-GENE-040724-187OMA, EggNOG
Zebrafish569142entpd2bectonucleoside triphosphate diphosphohydrolase 2b7955ZDB-GENE-061013-2Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.