Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.

Lenguaje

Moneda

Inicio
Targets(Human)
ERP29

ERP29

Descripción	Endoplasmic reticulum resident protein 29

Gene and Protein Information

Gene ID	10961
Uniprot Accession IDs	P30040 C9J183 Q3MJC3 Q6FHT4 ERp29
Ensembl ID	ENSP00000261735
Symbol	C12orf8 ERP28 ERp28 ERp31 PDIA9 PDI-DB C12orf8 HEL-S-107
Sequence	MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nombre	NIF	Other Gene ID	Sources
Chimp	738376	ERP29	endoplasmic reticulum protein 29	9598	VGNC:5368	OMA, EggNOG
Mouse	67397	Erp29	endoplasmic reticulum protein 29	10090	MGI:1914647	Inparanoid, OMA, EggNOG
Rat	117030	Erp29	endoplasmic reticulum protein 29	10116	RGD:619781	Inparanoid, OMA, EggNOG
Dog	477482	ERP29	endoplasmic reticulum protein 29	9615	VGNC:40468	Inparanoid, OMA, EggNOG
Horse	100057258	ERP29	endoplasmic reticulum protein 29	9796	VGNC:17675	Inparanoid, OMA, EggNOG
Cow	613357	ERP29	endoplasmic reticulum protein 29	9913	VGNC:28596	Inparanoid, OMA, EggNOG
Pig	100156625	ERP29	endoplasmic reticulum protein 29	9823		Inparanoid, OMA, EggNOG
Opossum		ERP29	endoplasmic reticulum protein 29 [Source:HGNC Symbol;Acc:HGNC:13799]	13616		Inparanoid, OMA, EggNOG
Platypus	100074933	ERP29	endoplasmic reticulum protein 29	9258		Inparanoid, OMA, EggNOG
Chicken	416882	ERP29	endoplasmic reticulum protein 29	9031	CGNC:50366	OMA, EggNOG
Anole lizard	100558558	erp29	endoplasmic reticulum protein 29	28377		Inparanoid, OMA, EggNOG
Xenopus		erp29	endoplasmic reticulum protein 29 [Source:Xenbase;Acc:XB-GENE-6045950]	8364		OMA, EggNOG
Fruitfly	37206	wbl	windbeutel	7227	FBgn0004003	Inparanoid, EggNOG

Associated Recombinant Proteins

Nombre	Specification and purity	Expression system	Protein label	Disponibilidad	Mostrar detalles

Associated Antibodies

Nombre	Specifications	Species reactivity	Aplicación	Disponibilidad	Mostrar detalles

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nombre	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.