🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SCTR

DescripciónSecretin receptor

Gene and Protein Information

Gene ID6344
Uniprot Accession IDs P47872 Q12961 Q13213 Q53T00 SCT-R
Ensembl ID ENSP00000019103
Symbol SR
FamilyBelongs to the G-protein coupled receptor 2 family.
Sequence
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459576SCTRsecretin receptor9598VGNC:2810OMA, EggNOG
Macaque695182SCTRsecretin receptor9544Inparanoid, OMA, EggNOG
Mouse319229Sctrsecretin receptor10090MGI:2441720Inparanoid, OMA, EggNOG
Rat81779Sctrsecretin receptor10116RGD:621342Inparanoid, OMA, EggNOG
Dog483883SCTRsecretin receptor9615VGNC:45934Inparanoid, OMA, EggNOG
Horse100051620SCTRsecretin receptor9796VGNC:51491Inparanoid, OMA, EggNOG
Cow523291SCTRsecretin receptor9913VGNC:34370Inparanoid, OMA, EggNOG
Pig100521045SCTRsecretin receptor9823Inparanoid, EggNOG
Opossum100013364SCTRsecretin receptor13616Inparanoid, OMA, EggNOG
Chicken770943SCTRsecretin receptor9031CGNC:9179Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class B secretin like    /    Glucagon receptor    /    Secretin receptor

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.