🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

EFHD1

DescripciónEF-hand domain-containing protein D1

Gene and Protein Information

Gene ID80303
Uniprot Accession IDs Q9BUP0 B2RD83 E9PFH3 Q9BTF8 Q9H8I2 Q9HBQ0
Ensembl ID ENSP00000264059
Symbol SWS2 SWS2 MST133 PP3051 MSTP133
Sequence
MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse98363Efhd1EF hand domain containing 110090MGI:1921607Inparanoid, OMA, EggNOG
Rat501181Efhd1EF-hand domain family, member D110116RGD:1559565Inparanoid, OMA, EggNOG
Cow522462EFHD1EF-hand domain family member D19913VGNC:28352Inparanoid, OMA
Chicken424741EFHD1EF-hand domain family member D19031CGNC:52247Inparanoid, OMA
Anole lizard100560636efhd1EF-hand domain family member D128377Inparanoid, OMA
Xenopus394919efhd1EF-hand domain family member D18364XB-GENE-5738953Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.