🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SYS1

DescripciónProtein SYS1 homolog

Gene and Protein Information

Gene ID90196
Uniprot Accession IDs Q8N2H4 C9JFB3 E1P620 Q5QPU7 Q96SD8 Q9BQZ2 Q9BQZ4 Q9H1F7
Ensembl ID ENSP00000243918
Symbol C20orf169 C20orf169 dJ453C12.4 dJ453C12.4.1
FamilyBelongs to the SYS1 family.
Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp458280SYS1SYS1, golgi trafficking protein9598VGNC:14305Inparanoid, OMA, EggNOG
Mouse66460Sys1SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)10090MGI:1913710Inparanoid, OMA, EggNOG
Rat685079Sys1Sys1 golgi trafficking protein10116RGD:1583224Inparanoid, OMA, EggNOG
Dog485894SYS1SYS1, golgi trafficking protein9615VGNC:54736OMA, EggNOG
Horse100070943SYS1SYS1, golgi trafficking protein9796OMA, EggNOG
Cow614236SYS1SYS1, golgi trafficking protein9913Inparanoid, OMA, EggNOG
Pig102162899SYS1SYS1, golgi trafficking protein9823OMA, EggNOG
Platypus100077615SYS1SYS1, golgi trafficking protein9258OMA, EggNOG
Chicken419183SYS1SYS1, golgi trafficking protein9031CGNC:2880Inparanoid, OMA, EggNOG
Anole lizard100558757sys1SYS1, golgi trafficking protein28377OMA, EggNOG
Xenopus548804sys1Sys1 golgi trafficking protein8364XB-GENE-5820723Inparanoid, OMA, EggNOG
C. elegans171969T03F1.12hypothetical protein6239OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.