🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

TOMM34

DescripciónMitochondrial import receptor subunit TOM34

Gene and Protein Information

Gene ID10953
Uniprot Accession IDs Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34
Ensembl ID ENSP00000361900
Symbol URCC3 TOM34 URCC3 HTOM34P
FamilyBelongs to the Tom34 family.
Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp458274TOMM34translocase of outer mitochondrial membrane 349598VGNC:6285Inparanoid, OMA, EggNOG
Mouse67145Tomm34translocase of outer mitochondrial membrane 3410090MGI:1914395Inparanoid, OMA, EggNOG
Rat311621Tomm34translocase of outer mitochondrial membrane 3410116RGD:1309029Inparanoid, OMA
Dog477239TOMM34translocase of outer mitochondrial membrane 349615VGNC:49628Inparanoid, OMA, EggNOG
Horse100070847TOMM34translocase of outer mitochondrial membrane 349796VGNC:50511Inparanoid, OMA, EggNOG
Cow508142TOMM34translocase of outer mitochondrial membrane 349913VGNC:49135Inparanoid, OMA, EggNOG
Pig100157194TOMM34translocase of outer mitochondrial membrane 349823Inparanoid, OMA, EggNOG
OpossumTOMM34translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:HGNC:15746]13616Inparanoid, EggNOG
Chicken419188TOMM34translocase of outer mitochondrial membrane 349031CGNC:3015Inparanoid, OMA
Anole lizard100561170tomm34translocase of outer mitochondrial membrane 3428377Inparanoid, OMA, EggNOG
Zebrafish323361tomm34translocase of outer mitochondrial membrane 347955ZDB-GENE-030131-2081Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.