🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

TPSG1

DescripciónTryptase gamma

Gene and Protein Information

Gene ID25823
Uniprot Accession IDs Q9NRR2 Q96RZ8 Q9C015 Q9NRQ8 Q9UBB2
Ensembl ID ENSP00000234798
Symbol PRSS31 TMT TMT trpA PRSS31
FamilyBelongs to the peptidase S1 family. Tryptase subfamily.
Sequence
MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque100425751TPSG1tryptase gamma 19544Inparanoid, OMA, EggNOG
Mouse26945Tpsg1tryptase gamma 110090MGI:1349391Inparanoid, OMA, EggNOG
Rat302990Tpsg1tryptase gamma 110116RGD:631355Inparanoid, OMA, EggNOG
Horse100067538TPSG1tryptase gamma 19796VGNC:24447Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase gamma
protein    /    calcium-binding protein    /    serine protease    /    Tryptase gamma
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase gamma
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase gamma
protein    /    calcium-binding protein    /    annexin    /    Tryptase gamma
protein    /    calcium-binding protein    /    receptor    /    Tryptase gamma
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Tryptase gamma

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.