for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
Apelin-36 (rat, mouse), CAS No.230299-95-3
Meccanismi biochimici e fisiologici
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50= 5.4 nM) and potently inhibits cAMP productionin vitro(EC50= 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and
Sequenza
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Tipo di azione
INHIBITOR
CAS
230299-95-3
Tipo di molecola
Piccola molecola
Stoccaggio e spedizione
Condizioni di conservazione di stoccaggio
Store at -20°C,Desiccated
Spedito in
Ice chest + Ice pads
Documentazione
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
