| 설명 | P2Y purinoceptor 11 |
|---|
Gene and Protein Information
| Gene ID | 5032 |
|---|---|
| Uniprot Accession IDs | Q96G91 B2R8X9 O43190 Q9BYU4 Q9H170 P2Y11 |
| Ensembl ID | ENSP00000323872 |
| Symbol | P2Y11 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Xenopus | 447996 | p2ry11 | purinergic receptor P2Y, G-protein coupled, 11 | 8364 | XB-GENE-6465757 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2Y purinoceptor 11
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2Y purinoceptor 11
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later