GCGR
Browse by type, application, or key specifications such as purity, grade, packaging, and handling requirements.
160 products
Popular Products
- Liraglutide, Glukagon-like peptide 1 receptor agonistMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥99%● In Stock — US warehouse, ships to EU* Item #: L276430View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- YSDQQAXHVYUZIW-QCIJIYAXSA-N
- InChI
- show more
- Synonyms
- Liraglutida | N26-(Hexadecanoyl-gamma-glutamyle)-(34-arginine)GLP-1-(7-37)-peptide | (4'-FURAN-2-YL-[4,5']BIPYRIMIDIN...
- Lixisenatide acetateCAS: 1997361-87-1 Formula: C215H347N61O65S.6C2H4O2 Molecular Weight: 4858.49（free base）● In Stock — US warehouse, ships to EU* Item #: L275704View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L...
- NNC 0640, Allosteric modulator of glukagon receptorCAS: 307986-98-7 Formula: C29H31N7O4S Molecular Weight: 573.67Solid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥97%(HPLC)● In Stock — US warehouse, ships to EU* Item #: N286700View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 4-[[4-cyclohexyl-N-[(3-methylsulfonylphenyl)carbamoyl]anilino]methyl]-N-(2H-tetrazol-5-yl)benzamide
- SMILES
- CS(=O)(=O)C1=CC=CC(=C1)NC(=O)N(CC2=CC=C(C=C2)C(=O)NC3=NNN=N3)C4=CC=C(C=C4)C5CCCCC5
- InChIKey
- PPTKULJUDJWTSA-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- 4-[[(4-Cyclohexylphenyl)[[[3-(methylsulfonyl)phenyl]amino]carbonyl]amino]methyl]-N-2H-tetrazol-5-ylbenzamide
- hGCGR Antagonist, Antagonist of glukagon receptorCAS: 438618-32-7 Formula: C20H30N2OS Molecular Weight: 346.5Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%◐ .Made to order · 8–12 wks Item #: G338729View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- N-[3-cyano-6-(2-methylbutan-2-yl)-4,5,6,7-tetrahydro-1-benzothiophen-2-yl]-2-ethylbutanamide
- SMILES
- CCC(CC)C(=O)NC1=C(C2=C(S1)CC(CC2)C(C)(C)CC)C#N
- InChIKey
- SWIBDWBSJSJQHL-UHFFFAOYSA-N
- InChI
- 1S/C20H30N2OS/c1-6-13(7-2)18(23)22-19-16(12-21)15-10-9-14(11-17(15)24-19)20(4,5)8-3/h13-14H,6-11H2,1-5H3,(H,22,23)
- Synonyms
- MFCD01920208 | NCGC00340210-02 | AKOS017343007 | N-[3-cyano-6-(2-methylbutan-2-yl)-4,5,6,7-tetrahydro-1-benzothiophen...
- VU 0650991CAS: 488097-06-9 EC Number: 963-629-8 PubChem CID: 1941609 Formula: C16H11ClF6N4O2 Molecular Weight: 440.73◐ .Made to order · 8–12 wks Item #: V288056View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 7-(4-chlorophenyl)-1,3-dimethyl-5,5-bis(trifluoromethyl)-8H-pyrimido[4,5-d]pyrimidine-2,4-dione
- SMILES
- CN1C2=C(C(=O)N(C1=O)C)C(N=C(N2)C3=CC=C(C=C3)Cl)(C(F)(F)F)C(F)(F)F
- InChIKey
- MFEIZMHODFOWAT-UHFFFAOYSA-N
- InChI
- 1S/C16H11ClF6N4O2/c1-26-11-9(12(28)27(2)13(26)29)14(15(18,19)20,16(21,22)23)25-10(24-11)7-3-5-8(17)6-4-7/h3-6H,1-2H3,(H,24,25)
- Synonyms
- 7-(4-Chlorophenyl)-5,8-dihydro-1,3-dimethyl-5,5-bis(trifluoromethyl)pyrimido[4,5-d]pyrimidine-2,4(1H,3H)-dione
- BETP, Allosteric modulator of GLP-1 receptorSolid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%(HPLC)● In Stock — US warehouse, ships to EU* Item #: B131969View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 2-ethylsulfinyl-4-(3-phenylmethoxyphenyl)-6-(trifluoromethyl)pyrimidine
- SMILES
- CCS(=O)C1=NC(=CC(=N1)C(F)(F)F)C2=CC(=CC=C2)OCC3=CC=CC=C3
- InChIKey
- NTDFYGSSDDMNHI-UHFFFAOYSA-N
- InChI
- 1S/C20H17F3N2O2S/c1-2-28(26)19-24-17(12-18(25-19)20(21,22)23)15-9-6-10-16(11-15)27-13-14-7-4-3-5-8-14/h3-12H,2,13H2,1H3
- Synonyms
- NCGC00379201-03 | E78417 | 4-(3-(benzyloxy)phenyl)-2-(ethylsulfinyl)-6-(trifluoromethyl)pyrimidine | BCP19312 | 2-eth...
- L-168,049, Antagonist of glukagon receptorCAS: 191034-25-0 Formula: C24H20BrClN2O Molecular Weight: 467.79Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥99%(HPLC)● In Stock — US warehouse, ships to EU* Item #: L287004View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 4-[3-(5-bromo-2-propoxyphenyl)-5-(4-chlorophenyl)-1H-pyrrol-2-yl]pyridine
- SMILES
- CCCOC1=C(C=C(C=C1)Br)C2=C(NC(=C2)C3=CC=C(C=C3)Cl)C4=CC=NC=C4
- InChIKey
- HHBOWXZOLYQFNY-UHFFFAOYSA-N
- InChI
- 1S/C24H20BrClN2O/c1-2-13-29-23-8-5-18(25)14-20(23)21-15-22(16-3-6-19(26)7-4-16)28-24(21)17-9-11-27-12-10-17/h3-12,14-15,28H,2,13H2,1H3
- Synonyms
- 4-[(2-amino-4-oxo-3H-pteridin-6-yl)methyl-(2,2,2-trifluoroacetyl)amino]benzoic acid | 4-[3-(5-Bromo-2-propoxy-phenyl)...
- Semaglutide, Agonist of GLP-1 receptorSolid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US warehouse, ships to EU* Item #: S304954View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- DLSWIYLPEUIQAV-CCUURXOWSA-N
- InChI
- show more
- Synonyms
- semaglutidum | NN 9535 | EX-A2424 | SEMAGLUTIDE COMPONENT OF NN1535 ICOSEMA | Ozempic | Rybelsus (oral semaglutide) |...
- Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptorCAS: 463930-25-8 PubChem CID: 72941824 Formula: C167H270N52O46• XCF3COOH Molecular Weight: 3742.29（free basis）Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%● In Stock — US warehouse, ships to EU* Item #: B288002View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- NHMJBXFCQMBYCP-ZBLLYJRDSA-N
- InChI
- show more
- Synonyms
- UNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser...
- GLP-1(7-36), amide TFACAS: 107444-51-9(free) Formula: C149H226N40O45 Molecular Weight: 3297.68● In Stock — US warehouse, ships to EU* Item #: G488919View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- Glucagon-Like Peptide 1 (7-36) Amide trifluoroacetate salt
- GLP-1 (7-37), Agonist of GLP-1 receptorMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%● In Stock — US warehouse, ships to EU* Item #: G287230View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- show more
- InChIKey
- GCYXWQUSHADNBF-AAEALURTSA-N
- Synonyms
- 1450806-98-0 | AKOS025142102 | GLP-1 (7-37) | DTXSID50147676 | GLP-1(7-37) Acetate | GLP-1(7-37) acetate(106612-94-6 ...
- Adomeglivant, Antagonist of glukagon receptorCAS: 1488363-78-5 Formula: C32H36F3NO4 Molecular Weight: 555.63Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. 10mM in DMSO● In Stock — US warehouse, ships to EU* Item #: A421743View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 3-[[4-[(1S)-1-[4-(4-tert-butylphenyl)-3,5-dimethylphenoxy]-4,4,4-trifluorobutyl]benzoyl]amino]propanoic acid
- SMILES
- CC1=CC(=CC(=C1C2=CC=C(C=C2)C(C)(C)C)C)OC(CCC(F)(F)F)C3=CC=C(C=C3)C(=O)NCCC(=O)O
- InChIKey
- FASLTMSUPQDLIB-MHZLTWQESA-N
- InChI
- show more
- Synonyms
- F85410 | AKOS040741049 | FASLTMSUPQDLIB-MHZLTWQESA-N | A858152 | ADOMEGLIVANT [WHO-DD] | .BETA.-ALANINE, N-(4-((1S)-1...
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
How is the GCGR listing put together?
It draws on reported GCGR annotations within GPCR/G Protein and lists each compound with its structure, identifiers, and the activity published for it. Always check the underlying assay before comparing potency values across entries.
How do I choose a GCGR modulator for my assay?
Start from the assay format and readout — biochemical, cell-based, or in vivo — then compare the GCGR entries on potency, selectivity over related family members, and solubility in your vehicle. Where several chemotypes are available, a reference compound plus a structurally unrelated backup is the usual way to control for off-target effects.
Which specifications matter most for GCGR compounds?
Purity and identity confirmation come first, then solubility in DMSO or your chosen vehicle, recommended storage temperature, and stability in solution. For GCGR work in particular, freshly prepared stocks avoid most of the reproducibility problems seen with stored plates. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
What if the GCGR compound I need is not listed?
Search by CAS number or SMILES first, since analogs of GCGR compounds are often catalogued under a related target. Custom synthesis and bulk enquiries go to [email protected]. We supply verified businesses, research institutions, universities, and government agencies.