Explore small molecules, screening libraries, and tool compounds for discovery research. Browse by target, pathway, or ligand family to quickly find inhibitors, agonists, and chemical probes, with searchable structure/CAS data and supporting documents (SDS/COA where available).
Targets & Pathways
Shop by category
Ready-to-screen compound libraries and focused sets for hit discovery. Browse libraries by target class, pathway, scaffold, or application, and review size, format, and compound information to build screening panels.Customize Your Screening Library to choose compounds, format, and volume, and we’ll prepare a ready-to-use set for you.Customize Your Screening Library
Ligand families
24,639Navigate small molecules by ligand family or scaffold to build focused sets and explore structure–activity relationships. This category groups related chemotypes, helping you select analogs, fragments, and tool molecules for discovery research.
ADC-focused building blocks and tools to support antibody–drug conjugate research. Explore payloads, linkers, conjugation reagents, and related small-molecule components (where available) for designing and evaluating ADC constructs.
PROTAC
2,815PROTAC and targeted protein degradation tools for discovery research. Browse degrader-related ligands, linkers, and building blocks (where available) to assemble or screen PROTAC designs, with clear identifiers for efficient selection.
By Signaling Pathways
102,615Explore pathway-focused tool compounds to study and modulate key signaling cascades. Browse small molecules grouped by signaling pathway to support mechanism studies, phenotypic assays, and target validation, with clear identifiers for fast searching.
By Target (DTO)
19,694Find bioactive small molecules organized by protein target (DTO). Quickly locate tool compounds for specific targets and compare identifiers such as structure, CAS, and synonyms—plus supporting documents —to build screening and validation sets.
By Disease (DOID)
8,779Shop small molecules and tool compounds organized by disease area (DOID). Discover chemical probes, libraries, and related products mapped to therapeutic areas to help assemble compound sets for screening, pathway exploration, and model studies.
Products
- Cholesterol (Water Soluble)Solid● In Stock — US warehouse, ships to EU* Item #: C659054View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- [Cholesterol-Water Soluble]
- Synonyms
- Cholesterol–methyl-β-cyclodextrin
- M2e, human TFAFormula: C109H171F3N32O43S2 Molecular Weight: 2738.83◐ Made to order · 8–12 wks Item #: M659031View ProductPricing & Pack Sizes
Technical Identifiers
- Glepaglutide acetateFormula: C199H329N53O57 Molecular Weight: 4376.13◐ Made to order · 8–12 wks Item #: G658965View ProductPricing & Pack Sizes
Technical Identifiers
- Pitavastatin-d4sodiumCAS: 574705-92-3(Unlabelled) Formula: C25H19D4FNNaO4 Molecular Weight: 447.47◐ Made to order · 8–12 wks Item #: P658949View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- (Z)-Pitavastatin-d4 Sodium Salt|(3R,5S,Z)-7-(2-(cyclopropyl-2,2,3,3-d4)-4-(4-fluorophenyl)quinolin-3-yl)-3,5-dihydrox...
- SPOP-IN-6b dihydrochlorideFormula: C28H34Cl2N6O3 Molecular Weight: 573.51◐ Made to order · 8–12 wks Item #: S658950View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- O=C(C(C(N1CCC2=CC=CC=C2)=N)=CC3=C1N=C(C(C)=CC=C4)N4C3=O)NCCCN5CCOCC5.[H]Cl.[H]Cl
- AZ14145845Formula: C32H35N9O Molecular Weight: 561.68◐ Made to order · 8–12 wks Item #: A658963View ProductPricing & Pack Sizes
Technical Identifiers
- CRF, bovine TFAFormula: C208H341F3N60O65S Molecular Weight: 4811.36◐ Made to order · 8–12 wks Item #: C658972View ProductPricing & Pack Sizes
Technical Identifiers
- Tau protein (592-597), human TFAFormula: C36H63F3N10O11 Molecular Weight: 868.94◐ Made to order · 8–12 wks Item #: T658975View ProductPricing & Pack Sizes
Technical Identifiers
- NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQFormula: C213H342N58O66S2\n Molecular Weight: 4835.47◐ Made to order · 8–12 wks Item #: N658979View ProductPricing & Pack Sizes
Technical Identifiers
- Autocamtide 2, amideFormula: C65H119N23O19 Molecular Weight: 1526.78◐ Made to order · 8–12 wks Item #: A658984View ProductPricing & Pack Sizes
Technical Identifiers
- Obeticholic Acid-d4Formula: C25H38D4O4 Molecular Weight: 410.62◐ Made to order · 8–12 wks Item #: O658978View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- C[C@@]([C@]1([H])[C@@H](C)[C@H]2O)(CC([2H])([2H])[C@@H](O)C1([2H])[2H])[C@]3([H])[C@]2([H])[C@@](CC[C@]4([H])[C@H](C)CCC(O)=O)([H])[C@]4(C)CC3
- Fluorescein-NAD+Formula: C56H64N10O22P2 Molecular Weight: 1291.11◐ Made to order · 8–12 wks Item #: F658989View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- show more
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
What does the By Target/Pathway/Disease listing cover?
It groups compounds associated with targets in By Target/Pathway/Disease, organised so you can move from the pathway to an individual target and then to a specific chemotype. Each entry carries structure, CAS number, and reported activity.
How is By Target/Pathway/Disease organised?
By Target/Pathway/Disease is broken down into Compound Libraries, PROTACs, molecular glues and other degraders and Antibody-drug Conjugates(ADC). Compounds acting on more than one node appear under each relevant target.
How do I choose compounds for By Target/Pathway/Disease research?
For By Target/Pathway/Disease, pick a well-characterised reference compound for the node you want to perturb, and pair it with a structurally unrelated compound hitting the same target — that is the cleanest way to separate pathway effects from off-target ones. Check potency, selectivity, and cell permeability against your assay format. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
How do I find a specific compound within By Target/Pathway/Disease?
Search By Target/Pathway/Disease by compound name, CAS number, or SMILES, or drill down through the target listing. Unlisted compounds and bulk quantities: [email protected]. We supply verified businesses, research institutions, universities, and government agencies.