Explore small molecules, screening libraries, and tool compounds for discovery research. Browse by target, pathway, or ligand family to quickly find inhibitors, agonists, and chemical probes, with searchable structure/CAS data and supporting documents (SDS/COA where available).
By Target / Pathway / Disease
Browse by type, application, or key specifications such as purity, grade, packaging, and handling requirements.
137,004 products
Shop by category
Ready-to-screen compound libraries and focused sets for hit discovery. Browse libraries by target class, pathway, scaffold, or application, and review size, format, and compound information to build screening panels.Customize Your Screening Library to choose compounds, format, and volume, and we’ll prepare a ready-to-use set for you.Customize Your Screening Library
Ligand families
24,653Navigate small molecules by ligand family or scaffold to build focused sets and explore structure–activity relationships. This category groups related chemotypes, helping you select analogs, fragments, and tool molecules for discovery research.
ADC-focused building blocks and tools to support antibody–drug conjugate research. Explore payloads, linkers, conjugation reagents, and related small-molecule components (where available) for designing and evaluating ADC constructs.
PROTAC
2,812PROTAC and targeted protein degradation tools for discovery research. Browse degrader-related ligands, linkers, and building blocks (where available) to assemble or screen PROTAC designs, with clear identifiers for efficient selection.
By Signaling Pathways
102,662Explore pathway-focused tool compounds to study and modulate key signaling cascades. Browse small molecules grouped by signaling pathway to support mechanism studies, phenotypic assays, and target validation, with clear identifiers for fast searching.
By Target (DTO)
19,717Find bioactive small molecules organized by protein target (DTO). Quickly locate tool compounds for specific targets and compare identifiers such as structure, CAS, and synonyms—plus supporting documents (where available)—to build screening and validation sets.
By Disease (DOID)
8,794Shop small molecules and tool compounds organized by disease area (DOID). Discover chemical probes, libraries, and related products mapped to therapeutic areas to help assemble compound sets for screening, pathway exploration, and model studies.
Popular Products
- Tiospirone hydrochloride● In Stock — US warehouse, ships to EU* Item #: T346409View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 8-[4-[4-(1,2-benzothiazol-3-yl)piperazin-1-yl]butyl]-8-azaspiro[4.5]decane-7,9-dione;hydrochloride
- SMILES
- C1CCC2(C1)CC(=O)N(C(=O)C2)CCCCN3CCN(CC3)C4=NSC5=CC=CC=C54.Cl
- InChIKey
- RYAWYTKDKQCORF-UHFFFAOYSA-N
- InChI
- 1S/C24H32N4O2S.ClH/c29-21-17-24(9-3-4-10-24)18-22(30)28(21)12-6-5-11-26-13-15-27(16-14-26)23-19-7-1-2-8-20(19)31-25-23;/h1-2,7-8H,3-6,9-18H2;1H
- Synonyms
- 8-[4-[4-(1,2-benzothiazol-3-yl)piperazin-1-yl]butyl]-8-azaspiro[4.5]decane-7,9-dione;hydrochloride | 45Q1DF53NN | BMY...
- Tyrphostin AG 537Formula: C₂₃H₂₀N₄O₆ Molecular Weight: 448.4◐ .Made to order · 8–12 wks Item #: T380749View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- DTXSID201017648 | Tyrphostin AG 537 | BDBM5149 | NCGC00016027-03 | 2-Cyano-N-{3-[2-cyano-3-(3,4-dihydroxyphenyl)allan...
- B-HT 920 dihydrochlorideCAS: 36085-73-1 EC Number: 629-837-5 PubChem CID: 104870 Formula: C10H15N3S·2HCl Molecular Weight: 282.23● In Stock — US warehouse, ships to EU* Item #: I390694View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 6-prop-2-enyl-4,5,7,8-tetrahydro-[1,3]thiazolo[4,5-d]azepin-2-amine;dihydrochloride
- SMILES
- C=CCN1CCC2=C(CC1)SC(=N2)N.Cl.Cl
- InChIKey
- DPQAXNSOFFYKDS-UHFFFAOYSA-N
- InChI
- 1S/C10H15N3S.2ClH/c1-2-5-13-6-3-8-9(4-7-13)14-10(11)12-8;;/h2H,1,3-7H2,(H2,11,12);2*1H
- Synonyms
- 2-Amino-6-allyl-4,5,7,8-tetrahydro-6H-thiazolo(5,4-d)azepin-dihydrochlorid [German] | 6-Allyl-5,6,7,8-tetrahydro-4H-t...
- 4-Aminophenyl 1-thio-beta-D-cellobioside◐ .Made to order · 8–12 wks Item #: A274945View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- (2S,4S,5S)-2-[(3S,4R,6S)-6-(4-aminophenyl)sulfanyl-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol
- SMILES
- C1=CC(=CC=C1N)SC2C(C(C(C(O2)CO)OC3C(C(C(C(O3)CO)O)O)O)O)O
- InChIKey
- RIQWCPMDWZXHSW-HALRCSOBSA-N
- InChI
- show more
- Synonyms
- (2S,4S,5S)-2-[(3S,4R,6S)-6-(4-aminophenyl)sulfanyl-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxan...
- lyso-Sulfatide ammonium salt◐ .Made to order · 8–12 wks Item #: L275748View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- [2-[(E)-2-amino-3-hydroxyoctadec-4-enoxy]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl] hydrogen sulfate
- SMILES
- CCCCCCCCCCCCCC=CC(C(COC1C(C(C(C(O1)CO)O)OS(=O)(=O)O)O)N)O
- InChIKey
- BXSULSOCJNTUJS-CCEZHUSRSA-N
- InChI
- show more
- Phrixotoxin-2CAS: 221889-63-0 Formula: C169H259N49O43S8 Molecular Weight: 3923◐ .Made to order · 8–12 wks Item #: P275431View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- YCQKWMWTCDEERKCCEGLVCRLWCKRIINM(Modifications:Met-31=C-terminalamide | Disulfidebridges:2-16,9-21and15-25)
- Isavuconazole-d4Solid ≥98 atom% D,≥98%● In Stock — US warehouse, ships to EU* Item #: I340270View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 2,3,5,6-tetradeuterio-4-[2-[(2R,3R)-3-(2,5-difluorophenyl)-3-hydroxy-4-(1,2,4-triazol-1-yl)butan-2-yl]-1,3-thiazol-4-yl]benzonitrile
- SMILES
- CC(C1=NC(=CS1)C2=CC=C(C=C2)C#N)C(CN3C=NC=N3)(C4=C(C=CC(=C4)F)F)O
- InChIKey
- DDFOUSQFMYRUQK-KUXFOAEVSA-N
- InChI
- show more
- Synonyms
- 4-[2-[(1R,2R)-2-(2,5-Difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-4-thiazolyl]benzonitrile-d4 ...
- β-Aminomethyl-benzeneethanolCAS: 62247-39-6 Formula: C9H13NO Molecular Weight: 151.21◐ .Made to order · 8–12 wks Item #: A355532View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 3-amino-2-phenylpropan-1-ol
- SMILES
- C1=CC=C(C=C1)C(CN)CO
- InChIKey
- DIVZNCUPEGZSEI-UHFFFAOYSA-N
- InChI
- 1S/C9H13NO/c10-6-9(7-11)8-4-2-1-3-5-8/h1-5,9,11H,6-7,10H2
- Synonyms
- AKOS000365584 | MFCD06227476 | 3-amino-2-phenylpropan-1-ol | EN300-99931 | 3-Amino-2-phenyl-1-propanol | beta-(aminom...
- IsoginkgetinCAS: 548-19-6 Formula: C32H22O10 Molecular Weight: 566.51● In Stock — US warehouse, ships to EU* Item #: I288348View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 8-[5-(5,7-dihydroxy-4-oxochromen-2-yl)-2-methoxyphenyl]-5,7-dihydroxy-2-(4-methoxyphenyl)chromen-4-one
- SMILES
- COC1=CC=C(C=C1)C2=CC(=O)C3=C(O2)C(=C(C=C3O)O)C4=C(C=CC(=C4)C5=CC(=O)C6=C(C=C(C=C6O5)O)O)OC
- InChIKey
- HUOOMAOYXQFIDQ-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- AS-56807 | CHEBI:79087 | KBio2_006022 | HY-N2117 | MFCD00597035 | BRD-K72661036-001-02-1 | KBioSS_000886 | 8-[5-(5,7-...
- γ-[2-Azidoethyl]-ATP (aqueous solution)◐ .Made to order · 8–12 wks Item #: A276381View ProductPricing & Pack Sizes
Technical Identifiers
- SR 3576● In Stock — US warehouse, ships to EU* Item #: S275279View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 3-[4-[(3-methylphenyl)carbamoylamino]pyrazol-1-yl]-N-(3,4,5-trimethoxyphenyl)benzamide
- SMILES
- CC1=CC(=CC=C1)NC(=O)NC2=CN(N=C2)C3=CC=CC(=C3)C(=O)NC4=CC(=C(C(=C4)OC)OC)OC
- InChIKey
- MTFAYLZZDJGFGV-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- 3-[4-[(3-methylphenyl)carbamoylamino]pyrazol-1-yl]-N-(3,4,5-trimethoxyphenyl)benzamide | 3-(4-(3-m-tolylureido)-1H-py...
- Isosilybin BCAS: 142796-22-3 Formula: C25H22O10 Molecular Weight: 482.44● In Stock — US warehouse, ships to EU* Item #: I339968View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- (2R,3R)-3,5,7-trihydroxy-2-[(2S,3S)-2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1,4-benzodioxin-6-yl]-2,3-dihydrochromen-4-one
- SMILES
- COC1=C(C=CC(=C1)C2C(OC3=C(O2)C=CC(=C3)C4C(C(=O)C5=C(C=C(C=C5O4)O)O)O)CO)O
- InChIKey
- FDQAOULAVFHKBX-WAABAYLZSA-N
- InChI
- show more
- Synonyms
- Isosilybin B | Silybin A2 | ISOSILYBIN B [MI] | E87190 | UNII-15EH97604R | (2R,3R)-3,5,7-trihydroxy-2-[(2S,3S)-2-(4-h...
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
What does the By Target/Pathway/Disease listing cover?
It groups compounds associated with targets in By Target/Pathway/Disease, organised so you can move from the pathway to an individual target and then to a specific chemotype. Each entry carries structure, CAS number, and reported activity.
How is By Target/Pathway/Disease organised?
By Target/Pathway/Disease is broken down into Compound Libraries, PROTACs, molecular glues and other degraders and Antibody-drug Conjugates(ADC). Compounds acting on more than one node appear under each relevant target.
How do I choose compounds for By Target/Pathway/Disease research?
For By Target/Pathway/Disease, pick a well-characterised reference compound for the node you want to perturb, and pair it with a structurally unrelated compound hitting the same target — that is the cleanest way to separate pathway effects from off-target ones. Check potency, selectivity, and cell permeability against your assay format. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
How do I find a specific compound within By Target/Pathway/Disease?
Search By Target/Pathway/Disease by compound name, CAS number, or SMILES, or drill down through the target listing. Unlisted compounds and bulk quantities: [email protected]. We supply verified businesses, research institutions, universities, and government agencies.