SA-HRP

Cat. No.: np156148
AVAILABLE TO ORDER
GRADE & PURITY Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed.
★
Size
Germany (EU)
USA*
Price
Qty
0.1ml
np156148-0.1ml
—
2 In stock

€47.64

€69.33
Save €21.69 (31.29%)
1ml
np156148-1ml
Made to order · 8–12 wks

€357.42

€520.56
Save €163.13 (31.34%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Azide Free, High Performance, Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed. Azide Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Background

Streptavidin is a non-glycosylated protein from the bacterium Streptomyces avidinii. Streptavidin homotetramers have a particularly high, non-covalent binding affinity for biotin. When conjugated with an enzyme (eg, Horseradish Peroxidase or Alkaline Phosphatase) and coupled with a colorimetric or luminescent substrate development system, streptavidin has found widespread use along with biotinylated antibodies in a number of applications including Western blot, ELISA, ELISPOT, immunocytochemistry and immunohistochemistry.

Recommended Usage:

WB: 1:10000 -1:100000

ELISA: 1:1000-1:10000

Avoid using biotin-containing solutions as diluents and solutions containing sodium azide. Sodium azide is an inhibitor of horseradish peroxidase. It is recommended that the reagent be titrated for optimal performance for each application.

Specifications

Product Name
SA-HRP
Synonyms
SA-HRP (HRP-labeled Streptavidin) | Streptavidin-Horseradish Peroxidase | SAv-HRP | SA V1 | SA V2 | streptavidin | Streptavidin V1 | Streptavidin V2
Grade
Azide Free, High Performance
Specifications & Purity
Azide Free, High Performance, Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed.
Species
Streptomyces avidinii
Sequence
MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLG STFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWT VAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVG HDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Protein Length
Full length protein
Conjugation
HRP
Source
Native
Note
This product can replace S292620.
Molecule Type
Protein
Storage and Shipping
Form
Liquid
Concentration
Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle and protected from prolonged exposure to light. Prepare working dilution on day of use.
Images

WB-Streptavidin (HRP) (np156148)
Various whole cell lysates were subjected to SDS PAGE followed by western blot with Streptavidin (HRP) (np156148) at dilution of 1:10000 incubated at room temperature for 1 hour. Biotin-γ-actin antibody as primary antibody. Developed using the ECL technique. Observed band size was 42kDa. Exposure time was 10s.

ELISA-Streptavidin (HRP) (np156148)
ELISA results of Streptavidin (HRP) (np156148) tested against Biotin-BSA. Each well was coated in duplicate with 1 ng of Biotin-BSA.

WB-Streptavidin (HRP) (np156148)
HT-29 whole cell lysate was subjected to SDS PAGE followed by western blot with Streptavidin (HRP) (np156148) at dilution of 1:5000 incubated at room temperature for 1 hour. Biotin-γ-actin antibody as primary antibody. Developed using the ECL technique. Observed band size was 42kDa. Exposure time was 8s.

Application
ApplicationDilution info
WB

1:10000-1:100000

ELISA

1/1000-1/10000

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

10 results found

Lot NumberCertificate TypeDateItem
ZJ26F0737773Certificate of AnalysisJul 28, 2026 np156148
ZJ26F0737772Certificate of AnalysisJul 28, 2026 np156148
ZJ23F0300087Certificate of AnalysisJun 16, 2026 np156148
ZJ25F0723953Certificate of AnalysisMay 20, 2026 np156148
ZJ26F0333146Certificate of AnalysisMar 17, 2026 np156148
ZJ26F0333147Certificate of AnalysisMar 17, 2026 np156148
ZJ24F0708372Certificate of AnalysisJul 16, 2024 np156148
ZJ24F0708371Certificate of AnalysisJul 16, 2024 np156148
ZJ24R0500601Certificate of AnalysisMay 25, 2024 np156148
ZJ23F0300088Certificate of AnalysisJan 26, 2024 np156148
Documents & Articles
How to find the right secondary antibody?
RNA dot blot protocol
Immunohistochemistry Protocol
Professional Guide to Streptavidin-Modified Proteins
Why Can Biotinylated Peptides Test Negative in Biotin Assays?
Strategies for Eluting Biotinylated Proteins and Nucleic Acids from Streptavidin Supports
How to Dissolve Biotin for Streptavidin Elution Buffers
Tyramide Signal Amplification in In Situ Fluorescence Detection
Practical Guide to TSA Tyramide Signal Amplification: How to Select Reagents, Optimize the Workflow, and Reduce Background When Detection Signals Are Weak for Low-Abundance Targets
Biotin-Streptavidin System: The Golden Tool for Protein Research
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Azide Free grade guide → View High Performance grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.