224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein-L-isoaspartate(D-aspartate) O-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 5110 |
|---|---|
| Uniprot Accession IDs | P22061 A8K109 J3KP72 Q14661 Q16556 Q5VYC1 Q5VYC2 Q93061 Q96II9 Q99625 Q9BQV7 Q9BQV8 Q9NP03 PIMT |
| Ensembl ID | ENSP00000356354 |
| Symbol | PIMT |
| Family | Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family. |
| Sequence | MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463062 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9598 | VGNC:49015 | OMA, EggNOG |
| Macaque | 695893 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9544 | OMA, EggNOG | |
| Mouse | 18537 | Pcmt1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 | 10090 | MGI:97502 | Inparanoid, OMA, EggNOG |
| Rat | 25604 | Pcmt1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 | 10116 | RGD:3268 | Inparanoid, OMA |
| Dog | 476242 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100064527 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 613854 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9913 | VGNC:53799 | Inparanoid, OMA, EggNOG |
| Pig | 100502562 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100032072 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100074562 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 428607 | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 9031 | CGNC:9409 | Inparanoid, OMA, EggNOG |
| Anole lizard | PCMT1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:HGNC Symbol;Acc:HGNC:8728] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 595004 | pcmt1 | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 8364 | XB-GENE-959017 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30751 | pcmt | protein-L-isoaspartate (D-aspartate) O-methyltransferase | 7955 | ZDB-GENE-990415-134 | Inparanoid, OMA, EggNOG |
| C. elegans | 178981 | pcm-1 | Protein-L-isoaspartate O-methyltransferase | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 40668 | Pcmt | Protein-L-isoaspartate (D-aspartate) O-methyltransferase | 7227 | FBgn0086768 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transferase / methyltransferase / Protein-L-isoaspartate(D-aspartate) O-methyltransferase
protein / transferase / methyltransferase / Protein-L-isoaspartate(D-aspartate) O-methyltransferase
DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Protein-L-isoaspartate(D-aspartate) O-methyltransferase
protein / Enzyme / Transferase / Methyltransferase / Protein-L-isoaspartate(D-aspartate) O-methyltransferase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.