🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS / CoA Structure Bulk & Custom
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PITPNB

DescriptionPhosphatidylinositol transfer protein beta isoform

Gene and Protein Information

Gene ID23760
Uniprot Accession IDs P48739 B3KYB8 B7Z7Q0 Q8N5W1 PI-TP-beta
Ensembl ID ENSP00000321266
Symbol VIB1B PtdInsTP PI-TP-beta
FamilyBelongs to the PtdIns transfer protein family. PI transfer class I subfamily.
Sequence
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458731PITPNBphosphatidylinositol transfer protein beta9598VGNC:5298OMA, EggNOG
Macaque713414PITPNBphosphatidylinositol transfer protein beta9544Inparanoid, OMA, EggNOG
Mouse56305Pitpnbphosphatidylinositol transfer protein, beta10090MGI:1927542Inparanoid, OMA, EggNOG
Rat114561Pitpnbphosphatidylinositol transfer protein, beta10116RGD:620143Inparanoid, OMA, EggNOG
Dog609712PITPNBphosphatidylinositol transfer protein beta9615VGNC:44584Inparanoid, OMA, EggNOG
Horse100059322PITPNBphosphatidylinositol transfer protein beta9796VGNC:21474Inparanoid, OMA, EggNOG
Cow613773PITPNBphosphatidylinositol transfer protein beta9913VGNC:32920Inparanoid, OMA, EggNOG
Pig100157274PITPNBphosphatidylinositol transfer protein beta9823OMA, EggNOG
Opossum100030478PITPNBphosphatidylinositol transfer protein beta13616OMA, EggNOG
Chicken416912PITPNBphosphatidylinositol transfer protein beta9031CGNC:4211Inparanoid, OMA
Xenopus780070pitpnb.2phosphatidylinositol transfer protein beta8364XB-GENE-949250Inparanoid, OMA, EggNOG
Zebrafish393894pitpnbphosphatidylinositol transfer protein, beta7955ZDB-GENE-040426-895Inparanoid, OMA
C. elegans190268Y54F10AR.1hypothetical protein6239OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.