224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Eukaryotic translation elongation factor 1 epsilon-1 |
|---|
Gene and Protein Information
| Gene ID | 9521 |
|---|---|
| Uniprot Accession IDs | O43324 C9JLK5 Q5THS2 |
| Ensembl ID | ENSP00000369038 |
| Symbol | AIMP3 P18 P18 AIMP3 |
| Sequence | MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462423 | EEF1E1 | eukaryotic translation elongation factor 1 epsilon 1 | 9598 | OMA, EggNOG | |
| Macaque | 695426 | EEF1E1 | eukaryotic translation elongation factor 1 epsilon 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66143 | Eef1e1 | eukaryotic translation elongation factor 1 epsilon 1 | 10090 | MGI:1913393 | Inparanoid, OMA, EggNOG |
| Rat | 291057 | Eef1e1 | eukaryotic translation elongation factor 1 epsilon 1 | 10116 | RGD:1311056 | Inparanoid, OMA, EggNOG |
| Dog | 478717 | EEF1E1 | eukaryotic translation elongation factor 1 epsilon 1 | 9615 | Inparanoid, OMA | |
| Cow | 617105 | EEF1E1 | eukaryotic translation elongation factor 1 epsilon 1 | 9913 | Inparanoid, OMA | |
| Chicken | 420865 | EEF1E1 | eukaryotic translation elongation factor 1 epsilon 1 | 9031 | CGNC:9688 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.