224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | GTP cyclohydrolase 1 |
|---|
Gene and Protein Information
| Gene ID | 2643 |
|---|---|
| Uniprot Accession IDs | P30793 Q6FHY7 Q9Y4I8 |
| Ensembl ID | ENSP00000419045 |
| Symbol | DYT5 GCH GCH DYT5 DYT14 DYT5a GTPCH1 HPABH4B GTP-CH-1 |
| Family | Belongs to the GTP cyclohydrolase I family. |
| Sequence | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743728 | GCH1 | GTP cyclohydrolase 1 | 9598 | VGNC:3419 | OMA, EggNOG |
| Macaque | 695675 | GCH1 | GTP cyclohydrolase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14528 | Gch1 | GTP cyclohydrolase 1 | 10090 | MGI:95675 | Inparanoid, OMA, EggNOG |
| Rat | 29244 | Gch1 | GTP cyclohydrolase 1 | 10116 | RGD:61992 | Inparanoid, OMA, EggNOG |
| Dog | 609393 | GCH1 | GTP cyclohydrolase 1 | 9615 | VGNC:41145 | Inparanoid, OMA, EggNOG |
| Cow | 286815 | GCH1 | GTP cyclohydrolase 1 | 9913 | VGNC:29286 | Inparanoid, OMA, EggNOG |
| Opossum | 100029138 | GCH1 | GTP cyclohydrolase 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 396146 | GCH1 | GTP cyclohydrolase 1 | 9031 | CGNC:9262 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560114 | gch1 | GTP cyclohydrolase 1 | 28377 | Inparanoid, EggNOG | |
| Xenopus | 448485 | gch1 | GTP cyclohydrolase 1 | 8364 | XB-GENE-961365 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100192219 | gch1 | GTP cyclohydrolase 1 | 7955 | ZDB-GENE-070720-5 | Inparanoid, OMA |
| C. elegans | 179472 | cat-4 | GTP cyclohydrolase 1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 37415 | Pu | Punch | 7227 | FBgn0003162 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 853183 | FOL2 | GTP cyclohydrolase I | 4932 | S000003499 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.