🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS / CoA Structure Bulk & Custom
Menu
Account
Settings
྾
340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SUB1

DescriptionActivated RNA polymerase II transcriptional coactivator p15

Gene and Protein Information

Gene ID10923
Uniprot Accession IDs P53999 Q96L29
Ensembl ID ENSP00000265073
Symbol PC4 RPO2TC1 P15 PC4 p14
FamilyBelongs to the transcriptional coactivator PC4 family.
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse20024Sub1SUB1 homolog (S. cerevisiae)10090MGI:104811Inparanoid, OMA, EggNOG
Rat192269Sub1SUB1 homolog, transcriptional regulator10116RGD:621582Inparanoid, OMA, EggNOG
Dog479283SUB1SUB1 homolog, transcriptional regulator9615OMA, EggNOG
Horse100068496SUB1SUB1 homolog, transcriptional regulator9796VGNC:23741Inparanoid, OMA, EggNOG
Cow533984SUB1SUB1 homolog, transcriptional regulator9913VGNC:35454Inparanoid, OMA, EggNOG
Opossum100015659SUB1SUB1 homolog, transcriptional regulator13616Inparanoid, OMA, EggNOG
Platypus100092955SUB1SUB1 homolog, transcriptional regulator9258Inparanoid, OMA, EggNOG
Chicken427425SUB1SUB1 homolog, transcriptional regulator9031CGNC:2359Inparanoid, OMA, EggNOG
Anole lizard100563239sub1SUB1 homolog, transcriptional regulator28377Inparanoid, OMA, EggNOG
Xenopus448190sub1SUB1 homolog, transcriptional regulator8364XB-GENE-1015843Inparanoid, OMA, EggNOG
Zebrafish553561sub1aSUB1 homolog, transcriptional regulator a7955ZDB-GENE-050522-151Inparanoid, OMA
C. elegans188475T13F2.2Putative RNA polymerase II transcriptional coactivator6239Inparanoid, OMA
Fruitfly34120Ssb-c31aSingle stranded-binding protein c31A7227FBgn0015299Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.