224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Pancreas transcription factor 1 subunit alpha |
|---|
Gene and Protein Information
| Gene ID | 256297 |
|---|---|
| Uniprot Accession IDs | Q7RTS3 Q9HC25 |
| Ensembl ID | ENSP00000365687 |
| Symbol | BHLHA29 PTF1P48 p48 PACA PAGEN2 bHLHa29 PTF1-p48 |
| Sequence | MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 19213 | Ptf1a | pancreas specific transcription factor, 1a | 10090 | MGI:1328312 | Inparanoid, OMA, EggNOG |
| Rat | 117034 | Ptf1a | pancreas associated transcription factor 1a | 10116 | RGD:621709 | Inparanoid, OMA, EggNOG |
| Dog | 608313 | PTF1A | pancreas associated transcription factor 1a | 9615 | VGNC:52912 | Inparanoid, OMA, EggNOG |
| Horse | PTF1A | pancreas specific transcription factor, 1a [Source:HGNC Symbol;Acc:HGNC:23734] | 9796 | OMA, EggNOG | ||
| Cow | 781540 | PTF1A | pancreas associated transcription factor 1a | 9913 | VGNC:33498 | Inparanoid, OMA, EggNOG |
| Pig | 100623168 | PTF1A | pancreas specific transcription factor, 1a | 9823 | OMA, EggNOG | |
| Opossum | 100019635 | PTF1A | pancreas specific transcription factor, 1a | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100567005 | ptf1a | pancreas specific transcription factor, 1a | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100494161 | ptf1a | pancreas associated transcription factor 1a | 8364 | XB-GENE-484425 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368662 | ptf1a | pancreas associated transcription factor 1a | 7955 | ZDB-GENE-030616-579 | Inparanoid, OMA, EggNOG |
| Fruitfly | 2768661 | Fer1 | 48 related 1 | 7227 | FBgn0037475 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.