340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Persephin |
|---|
Gene and Protein Information
| Gene ID | 5623 |
|---|---|
| Uniprot Accession IDs | O60542 PSP |
| Ensembl ID | ENSP00000245810 |
| Symbol | PSP |
| Family | Belongs to the TGF-beta family. GDNF subfamily. |
| Sequence | MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 19197 | Pspn | persephin | 10090 | MGI:1201684 | Inparanoid, OMA, EggNOG |
| Rat | 25525 | Pspn | persephin | 10116 | RGD:3432 | Inparanoid, OMA, EggNOG |
| Dog | 611734 | PSPN | persephin | 9615 | VGNC:49950 | Inparanoid, OMA, EggNOG |
| Cow | 518266 | PSPN | persephin | 9913 | VGNC:52869 | Inparanoid, OMA, EggNOG |
| Pig | 100518237 | PSPN | persephin | 9823 | OMA, EggNOG | |
| Anole lizard | PSPN | persephin [Source:HGNC Symbol;Acc:HGNC:9579] | 28377 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.