224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | U2 small nuclear ribonucleoprotein B'' |
|---|
Gene and Protein Information
| Gene ID | 6629 |
|---|---|
| Uniprot Accession IDs | P08579 B2R7J3 D3DW21 Q9UJD4 U2 snRNP B'' |
| Ensembl ID | ENSP00000246071 |
| Symbol | Msl1 U2B'' |
| Family | Belongs to the RRM U1 A/B'' family. |
| Sequence | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458105 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9598 | VGNC:9995 | OMA, EggNOG |
| Mouse | 20639 | Snrpb2 | U2 small nuclear ribonucleoprotein B | 10090 | MGI:104805 | OMA, EggNOG |
| Rat | 362223 | Snrpb2 | small nuclear ribonucleoprotein polypeptide B2 | 10116 | RGD:1310194 | OMA, EggNOG |
| Dog | 477148 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9615 | OMA, EggNOG | |
| Horse | 100050830 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9796 | VGNC:23396 | OMA, EggNOG |
| Cow | 767873 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9913 | VGNC:35077 | OMA, EggNOG |
| Platypus | 100078690 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9258 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.