🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SBDS

DescriptionRibosome maturation protein SBDS

Gene and Protein Information

Gene ID51119
Uniprot Accession IDs Q9Y3A5 A8K0P4 Q96FX0 Q9NV53
Ensembl ID ENSP00000246868
Symbol SDS SWDS CGI-97
FamilyBelongs to the SDO1/SBDS family.
Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463942SBDSSBDS, ribosome maturation factor9598VGNC:8747OMA, EggNOG
Mouse66711SbdsSBDS ribosome maturation factor10090MGI:1913961Inparanoid, OMA, EggNOG
Rat288615SbdsSBDS, ribosome maturation factor10116RGD:1311043Inparanoid, OMA, EggNOG
Dog607017SBDSSBDS, ribosome maturation factor9615VGNC:45881Inparanoid, OMA, EggNOG
Horse100060921SBDSSBDS, ribosome maturation factor9796VGNC:22704Inparanoid, OMA, EggNOG
Cow513237SBDSSBDS, ribosome maturation factor9913VGNC:34304Inparanoid, OMA, EggNOG
Pig100516003SBDSSBDS, ribosome maturation factor9823Inparanoid, OMA, EggNOG
Opossum100010489SBDSSBDS, ribosome maturation factor13616Inparanoid, OMA, EggNOG
Platypus100093615SBDSSBDS, ribosome maturation factor9258Inparanoid, OMA, EggNOG
Chicken417477SBDSSBDS ribosome assembly guanine nucleotide exchange factor9031CGNC:749Inparanoid, OMA
Xenopus448365sbdsSBDS ribosome assembly guanine nucleotide exchange factor8364XB-GENE-1003506Inparanoid, OMA, EggNOG
Zebrafish394096sbdsSBDS, ribosome maturation factor7955ZDB-GENE-040426-1116Inparanoid, OMA, EggNOG
C. elegans175218sbds-1Ribosome maturation protein SBDS6239Inparanoid, OMA
Fruitfly38749CG8549CG8549 gene product from transcript CG8549-RA7227FBgn0035714Inparanoid, EggNOG
S.cerevisiae850709SDO1guanine nucleotide exchange factor SDO14932S000004012Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    transcription factor    /    Ribosome maturation protein SBDS
protein    /    nucleic acid binding    /    nuclease    /    Ribosome maturation protein SBDS
DTO Classes
protein    /    Enzyme    /    Nuclease    /    Ribosome maturation protein SBDS

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.