224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | G-protein coupled receptor 12 |
|---|
Gene and Protein Information
| Gene ID | 2835 |
|---|---|
| Uniprot Accession IDs | P47775 Q5T8P3 |
| Ensembl ID | ENSP00000384932 |
| Symbol | GPCR12 GPCR21 PPP1R84 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 14738 | Gpr12 | G-protein coupled receptor 12 | 10090 | MGI:101909 | Inparanoid, OMA, EggNOG |
| Rat | 80840 | Gpr12 | G protein-coupled receptor 12 | 10116 | RGD:68333 | Inparanoid, OMA, EggNOG |
| Dog | 486034 | GPR12 | G protein-coupled receptor 12 | 9615 | VGNC:41395 | Inparanoid, OMA |
| Horse | 100050970 | GPR12 | G protein-coupled receptor 12 | 9796 | VGNC:18508 | Inparanoid, OMA |
| Cow | 522747 | GPR12 | G protein-coupled receptor 12 | 9913 | VGNC:29547 | Inparanoid, OMA |
| Pig | 100736641 | GPR12 | G protein-coupled receptor 12 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019540 | GPR12 | G protein-coupled receptor 12 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | GPR12 | G protein-coupled receptor 12 [Source:HGNC Symbol;Acc:HGNC:4466] | 9258 | OMA, EggNOG | ||
| Chicken | 428079 | GPR12 | G protein-coupled receptor 12 | 9031 | CGNC:12847 | Inparanoid, OMA |
| Anole lizard | 100552481 | gpr12 | G protein-coupled receptor 12 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 565609 | gpr12 | G protein-coupled receptor 12 | 7955 | ZDB-GENE-100209-3 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 12
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 12
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.