224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fibroblast growth factor 12 |
|---|
Gene and Protein Information
| Gene ID | 2257 |
|---|---|
| Uniprot Accession IDs | P61328 B2R6B7 B2R976 O35339 P70376 Q8TBG5 Q92912 Q93001 FGF-12 |
| Ensembl ID | ENSP00000413496 |
| Symbol | FGF12B FHF1 FHF1 EIEE47 FGF12B |
| Family | Belongs to the heparin-binding growth factors family. |
| Sequence | MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 705813 | FGF12 | fibroblast growth factor 12 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14167 | Fgf12 | fibroblast growth factor 12 | 10090 | MGI:109183 | Inparanoid, OMA, EggNOG |
| Rat | 170630 | Fgf12 | fibroblast growth factor 12 | 10116 | RGD:620163 | Inparanoid, OMA |
| Dog | 478676 | FGF12 | fibroblast growth factor 12 | 9615 | VGNC:40841 | Inparanoid, OMA, EggNOG |
| Horse | 100059907 | FGF12 | fibroblast growth factor 12 | 9796 | VGNC:18011 | Inparanoid, OMA, EggNOG |
| Cow | 615823 | FGF12 | fibroblast growth factor 12 | 9913 | VGNC:53568 | Inparanoid, OMA, EggNOG |
| Opossum | 100010502 | FGF12 | fibroblast growth factor 12 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100554590 | LOC100554590 | fibroblast growth factor 12 | 28377 | OMA, EggNOG | |
| Xenopus | 100101804 | fgf12 | fibroblast growth factor 12 | 8364 | XB-GENE-479999 | Inparanoid, OMA |
| Zebrafish | 777735 | fgf12a | fibroblast growth factor 12a | 7955 | ZDB-GENE-050221-6 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.