224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | CAAX prenyl protease 2 |
|---|
Gene and Protein Information
| Gene ID | 9986 |
|---|---|
| Uniprot Accession IDs | Q9Y256 Q52LZ9 |
| Ensembl ID | ENSP00000309163 |
| Symbol | FACE2 RCE1A RCE1B FACE2 RCE1A RCE1B |
| Family | Belongs to the peptidase U48 family. |
| Sequence | MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451355 | RCE1 | Ras converting CAAX endopeptidase 1 | 9598 | VGNC:1027 | OMA, EggNOG |
| Macaque | 713224 | RCE1 | Ras converting CAAX endopeptidase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19671 | Rce1 | Ras converting CAAX endopeptidase 1 | 10090 | MGI:1336895 | Inparanoid, OMA, EggNOG |
| Rat | 309153 | Rce1 | Ras converting CAAX endopeptidase 1 | 10116 | RGD:1309261 | Inparanoid, OMA, EggNOG |
| Dog | 483705 | RCE1 | Ras converting CAAX endopeptidase 1 | 9615 | Inparanoid, EggNOG | |
| Horse | 100052803 | RCE1 | Ras converting CAAX endopeptidase 1 | 9796 | VGNC:22270 | Inparanoid, OMA, EggNOG |
| Cow | 539539 | RCE1 | Ras converting CAAX endopeptidase 1 | 9913 | VGNC:33828 | Inparanoid, OMA, EggNOG |
| Pig | 100514389 | RCE1 | Ras converting CAAX endopeptidase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015109 | RCE1 | Ras converting CAAX endopeptidase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100556866 | rce1 | Ras converting CAAX endopeptidase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549000 | rce1 | Ras converting CAAX endopeptidase 1 | 8364 | XB-GENE-979449 | Inparanoid, OMA, EggNOG |
| Zebrafish | 557720 | rce1a | Ras converting CAAX endopeptidase 1a | 7955 | ZDB-GENE-041008-116 | Inparanoid, OMA, EggNOG |
| C. elegans | 3565253 | fce-2 | CAAX prenyl protease 2 homolog | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 44002 | Sras | severas | 7227 | FBgn0029121 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855317 | RCE1 | CAAX prenyl protease | 4932 | S000004887 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.