340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Metalloproteinase inhibitor 1 |
|---|
Gene and Protein Information
| Gene ID | 7076 |
|---|---|
| Uniprot Accession IDs | P01033 Q14252 Q9UCU1 |
| Ensembl ID | ENSP00000218388 |
| Symbol | CLGI TIMP EPA EPO HCI CLGI TIMP TIMP-1 |
| Family | Belongs to the protease inhibitor I35 (TIMP) family. |
| Sequence | MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 574348 | TIMP1 | TIMP metallopeptidase inhibitor 1 | 9544 | Inparanoid, OMA | |
| Mouse | 21857 | Timp1 | tissue inhibitor of metalloproteinase 1 | 10090 | MGI:98752 | Inparanoid, OMA, EggNOG |
| Rat | 116510 | Timp1 | TIMP metallopeptidase inhibitor 1 | 10116 | RGD:621675 | Inparanoid, OMA, EggNOG |
| Dog | 403816 | TIMP1 | TIMP metallopeptidase inhibitor 1 | 9615 | VGNC:47376 | Inparanoid, OMA, EggNOG |
| Cow | 282092 | TIMP1 | TIMP metallopeptidase inhibitor 1 | 9913 | VGNC:35870 | Inparanoid, OMA, EggNOG |
| Pig | 396862 | TIMP1 | TIMP metallopeptidase inhibitor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100551718 | LOC100551718 | metalloproteinase inhibitor 1 | 28377 | OMA, EggNOG | |
| Fruitfly | 41248 | Timp | Tissue inhibitor of metalloproteases | 7227 | FBgn0025879 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.