🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS / CoA Structure Bulk & Custom
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

EPGN

DescriptionEpigen

Gene and Protein Information

Gene ID255324
Uniprot Accession IDs Q6UW88 A1BMM3 A1BMM4 A1BMM5 A1BMM6 A1BMM7 A1BMM8 A8K090
Ensembl ID ENSP00000411898
Symbol EPG PRO9904 ALGV3072
Sequence
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461252EPGNepithelial mitogen9598VGNC:2034OMA, EggNOG
Macaque702632EPGNepithelial mitogen9544Inparanoid, OMA, EggNOG
Mouse71920Epgnepithelial mitogen10090MGI:1919170Inparanoid, OMA, EggNOG
RatAC108576.1-10116OMA, EggNOG
Dog611937EPGNepithelial mitogen9615VGNC:40403Inparanoid, OMA, EggNOG
Horse100050376EPGNepithelial mitogen9796VGNC:51183Inparanoid, OMA, EggNOG
Cow100295331EPGNepithelial mitogen9913VGNC:53711OMA, EggNOG
Opossum100023880EPGNepithelial mitogen13616Inparanoid, OMA, EggNOG
PlatypusEPGNepithelial mitogen [Source:HGNC Symbol;Acc:HGNC:17470]9258OMA, EggNOG
Chicken497270EPGNepithelial mitogen9031CGNC:8250Inparanoid, OMA, EggNOG
Anole lizardEPGNepithelial mitogen [Source:HGNC Symbol;Acc:HGNC:17470]28377Inparanoid, OMA, EggNOG
Xenopus100216288epgnepithelial mitogen8364XB-GENE-975143Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Epigen
DTO Classes
protein    /    Signaling    /    Growth factor    /    Epigen

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.