Lixisenatide acetate - ≥98% , CAS No.1997361-87-1

CAS: 1997361-87-1 Cat. No.: L275704 Formula: C₂₁₅H₃₄₇N₆₁O₆₅S.6C₂H₄O₂ Peso molecolare: 4858.49（free base）

GRADE & PURITY ≥98%

Synonyms

AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu

Storage

Store at -20°C,Argon charged

Shipped In

Ice chest + Ice pads

Panoramica

Shipped at 4°C. Store at -20°C.

Specifications

Sinonimi

AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu

Specifiche e purezza

≥98%

Meccanismi biochimici e fisiologici

Lixisenatide is a short acting, potent and selective short peptide-based GLP-1 receptor agonist. The in vivo half-life is\xa0 2-4 hours. Displays an IC 50 of 1.4 nM at the human GLP-1 receptor in in vitro binding assays.

Condizioni di conservazione di stoccaggio

Store at -20°C,Argon charged

Spedito in

Ice chest + Ice pads

Questo prodotto richiede spedizione a catena fredda. I servizi di terra e altri servizi economici non sono disponibili.

Purezza

≥98%

Nomi e identificatori

• CAS alternativo: CAS 320367-13-3 (free base)
• Peso molecolare: 4858.49（free base）

Proprietà chimiche e fisiche

• Solubilità: soluble in water to 100 mg/mL .
• Sensibilità: Moisture sensitive

Domande frequenti

What is the purity of this product?

This product is supplied at ≥98% purity (chemical assay). Lot-specific values are stated on the Certificate of Analysis.

How should this product be stored?

Store at ?20 °C under argon. It is supplied under an argon blanket; reseal under inert gas after each use.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What are the CAS number, molecular formula and molecular weight?

The CAS Number is 1997361-87-1, the molecular formula is C215H347N61O65S.XC2H4O2, and the molecular weight is 4858.49（free base） g/mol.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.