GCGR
Browse by type, application, or key specifications such as purity, grade, packaging, and handling requirements.
161 products
Popular Products
- Liraglutide, Glukagon-like peptide 1 receptor agonistMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥99%In Stock Item #: L276430View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- YSDQQAXHVYUZIW-QCIJIYAXSA-N
- InChI
- show more
- Synonyms
- Liraglutida | N26-(Hexadecanoyl-gamma-glutamyle)-(34-arginine)GLP-1-(7-37)-peptide | (4'-FURAN-2-YL-[4,5']BIPYRIMIDIN...
- Lixisenatide acetateCAS: 1997361-87-1 Formula: C215H347N61O65S.6C2H4O2 Molecular Weight: 4858.49(free base)In Stock Item #: L275704View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L...
- NNC 0640, Allosteric modulator of glukagon receptorCAS: 307986-98-7 Formula: C29H31N7O4S Molecular Weight: 573.67Solid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥97%(HPLC)In Stock Item #: N286700View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 4-[[4-cyclohexyl-N-[(3-methylsulfonylphenyl)carbamoyl]anilino]methyl]-N-(2H-tetrazol-5-yl)benzamide
- SMILES
- CS(=O)(=O)C1=CC=CC(=C1)NC(=O)N(CC2=CC=C(C=C2)C(=O)NC3=NNN=N3)C4=CC=C(C=C4)C5CCCCC5
- InChIKey
- PPTKULJUDJWTSA-UHFFFAOYSA-N
- InChI
- show more
- Synonyms
- 4-[[(4-Cyclohexylphenyl)[[[3-(methylsulfonyl)phenyl]amino]carbonyl]amino]methyl]-N-2H-tetrazol-5-ylbenzamide
- hGCGR Antagonist, Antagonist of glukagon receptorCAS: 438618-32-7 Formula: C20H30N2OS Molecular Weight: 346.5Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%Out of Stock Item #: G338729View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- N-[3-cyano-6-(2-methylbutan-2-yl)-4,5,6,7-tetrahydro-1-benzothiophen-2-yl]-2-ethylbutanamide
- SMILES
- CCC(CC)C(=O)NC1=C(C2=C(S1)CC(CC2)C(C)(C)CC)C#N
- InChIKey
- SWIBDWBSJSJQHL-UHFFFAOYSA-N
- InChI
- 1S/C20H30N2OS/c1-6-13(7-2)18(23)22-19-16(12-21)15-10-9-14(11-17(15)24-19)20(4,5)8-3/h13-14H,6-11H2,1-5H3,(H,22,23)
- Synonyms
- MFCD01920208 | NCGC00340210-02 | AKOS017343007 | N-[3-cyano-6-(2-methylbutan-2-yl)-4,5,6,7-tetrahydro-1-benzothiophen...
- VU 0650991CAS: 488097-06-9 EC Number: 963-629-8 PubChem CID: 1941609 Formula: C16H11ClF6N4O2 Molecular Weight: 440.73Out of Stock Item #: V288056View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 7-(4-chlorophenyl)-1,3-dimethyl-5,5-bis(trifluoromethyl)-8H-pyrimido[4,5-d]pyrimidine-2,4-dione
- SMILES
- CN1C2=C(C(=O)N(C1=O)C)C(N=C(N2)C3=CC=C(C=C3)Cl)(C(F)(F)F)C(F)(F)F
- InChIKey
- MFEIZMHODFOWAT-UHFFFAOYSA-N
- InChI
- 1S/C16H11ClF6N4O2/c1-26-11-9(12(28)27(2)13(26)29)14(15(18,19)20,16(21,22)23)25-10(24-11)7-3-5-8(17)6-4-7/h3-6H,1-2H3,(H,24,25)
- Synonyms
- 7-(4-Chlorophenyl)-5,8-dihydro-1,3-dimethyl-5,5-bis(trifluoromethyl)pyrimido[4,5-d]pyrimidine-2,4(1H,3H)-dione
- BETP, Allosteric modulator of GLP-1 receptorMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%(HPLC)In Stock Item #: B131969View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 2-ethylsulfinyl-4-(3-phenylmethoxyphenyl)-6-(trifluoromethyl)pyrimidine
- SMILES
- CCS(=O)C1=NC(=CC(=N1)C(F)(F)F)C2=CC(=CC=C2)OCC3=CC=CC=C3
- InChIKey
- NTDFYGSSDDMNHI-UHFFFAOYSA-N
- InChI
- 1S/C20H17F3N2O2S/c1-2-28(26)19-24-17(12-18(25-19)20(21,22)23)15-9-6-10-16(11-15)27-13-14-7-4-3-5-8-14/h3-12H,2,13H2,1H3
- Synonyms
- NCGC00379201-03 | E78417 | 4-(3-(benzyloxy)phenyl)-2-(ethylsulfinyl)-6-(trifluoromethyl)pyrimidine | BCP19312 | 2-eth...
- L-168,049, Antagonist of glukagon receptorCAS: 191034-25-0 Formula: C24H20BrClN2O Molecular Weight: 467.79Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥99%(HPLC)In Stock Item #: L287004View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 4-[3-(5-bromo-2-propoxyphenyl)-5-(4-chlorophenyl)-1H-pyrrol-2-yl]pyridine
- SMILES
- CCCOC1=C(C=C(C=C1)Br)C2=C(NC(=C2)C3=CC=C(C=C3)Cl)C4=CC=NC=C4
- InChIKey
- HHBOWXZOLYQFNY-UHFFFAOYSA-N
- InChI
- 1S/C24H20BrClN2O/c1-2-13-29-23-8-5-18(25)14-20(23)21-15-22(16-3-6-19(26)7-4-16)28-24(21)17-9-11-27-12-10-17/h3-12,14-15,28H,2,13H2,1H3
- Synonyms
- 4-[(2-amino-4-oxo-3H-pteridin-6-yl)methyl-(2,2,2-trifluoroacetyl)amino]benzoic acid | 4-[3-(5-Bromo-2-propoxy-phenyl)...
- Semaglutide, Agonist of GLP-1 receptorSolid Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%In Stock Item #: S304954View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- DLSWIYLPEUIQAV-CCUURXOWSA-N
- InChI
- show more
- Synonyms
- semaglutidum | NN 9535 | EX-A2424 | SEMAGLUTIDE COMPONENT OF NN1535 ICOSEMA | Ozempic | Rybelsus (oral semaglutide) |...
- Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptorCAS: 463930-25-8 PubChem CID: 72941824 Formula: C167H270N52O46• XCF3COOH Molecular Weight: 3742.29(free basis)Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%In Stock Item #: B288002View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- show more
- SMILES
- show more
- InChIKey
- NHMJBXFCQMBYCP-ZBLLYJRDSA-N
- InChI
- show more
- Synonyms
- UNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser...
- GLP-1(7-36), amide TFACAS: 107444-51-9(free) Formula: C149H226N40O45 Molecular Weight: 3297.68In Stock Item #: G488919View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- Glucagon-Like Peptide 1 (7-36) Amide trifluoroacetate salt
- GLP-1 (7-37), Agonist of GLP-1 receptorMoligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%In Stock Item #: G287230View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- show more
- InChIKey
- GCYXWQUSHADNBF-AAEALURTSA-N
- Synonyms
- 1450806-98-0 | AKOS025142102 | GLP-1 (7-37) | DTXSID50147676 | GLP-1(7-37) Acetate | GLP-1(7-37) acetate(106612-94-6 ...
- Adomeglivant, Antagonist of glukagon receptorCAS: 1488363-78-5 Formula: C32H36F3NO4 Molecular Weight: 555.63Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. 10mM in DMSOIn Stock Item #: A421743View ProductPricing & Pack Sizes
Technical Identifiers
- IUPAC Name
- 3-[[4-[(1S)-1-[4-(4-tert-butylphenyl)-3,5-dimethylphenoxy]-4,4,4-trifluorobutyl]benzoyl]amino]propanoic acid
- SMILES
- CC1=CC(=CC(=C1C2=CC=C(C=C2)C(C)(C)C)C)OC(CCC(F)(F)F)C3=CC=C(C=C3)C(=O)NCCC(=O)O
- InChIKey
- FASLTMSUPQDLIB-MHZLTWQESA-N
- InChI
- show more
- Synonyms
- F85410 | AKOS040741049 | FASLTMSUPQDLIB-MHZLTWQESA-N | A858152 | ADOMEGLIVANT [WHO-DD] | .BETA.-ALANINE, N-(4-((1S)-1...
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use












