LL-37 acetate , CAS No.154947-66-7(free)
Em stock
SKU
L287236
Antimicrobial peptide derivative of human cathelicidin
Product Describtion:
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing
Mais informação
| Product Description | Product Describtion: LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing |
|---|---|
| Especificações e pureza | Moligand™, ≥98% |
| Sequência | [LL-37, 37 aa] |
| CAS | 154947-66-7(free) |
| Condições de armazenamento de armazenamento | Protected from light,Store at -20°C,Argon charged |
| Enviado em | Ice chest + Ice pads |
| Pubchem Sid Url | https://pubchem.ncbi.nlm.nih.gov/substance/488199067 |
| Sensibilidade | Moisture sensitive;Light sensitive |
| Solubilidade | Soluble to 1 (mg/mL) in water |
| Fórmula molecular | C205H340N60O53(freebase) |
| Pubchem Sid | 488199067 |
Revisões
Avaliações dos Clientes
Encontrámos outros produtos que podem ser do seu interesse!
-
LL-37 acetateDesde 178,67 €
Remind me later