Determine the necessary mass, volume, or concentration for preparing a solution.
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Disponível para encomenda
GRADE & PURITY ≥97%
Alternar Nav 
Pesquisa
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
Why this grade
≥97% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Visão geral
Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a Glukagon-like peptide 1 (GLP-1) receptor agonist.
Specifications
Product Name
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Sinónimos
Glucagon (1-37)（TFA） | Enteroglucagon（TFA）
Especificações e pureza
≥97%
Sequência
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
CAS
62340-29-8(free base)
Tipo de molécula
Peptide
Armazenamento e envio
Condições de armazenamento de armazenamento
Store at -20°C,Desiccated
Enviado em
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados（CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Data | Item |
|---|---|---|---|
 C23281113 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281114 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281115 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281121 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C2329405 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C2329472 | Certificate of Analysis | Jan 07, 2023 | O287276 |
Calculadoras de soluções
Revisões
Avaliações dos Clientes
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.