Recombinant Human Apolipoprotein E3 Protein, >95%(SDS-PAGE)

Cat. No.: rp142912
Disponível para encomenda
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P02649
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Human ApoE at 5μg/mL (100 μL/well) can bind Human TREM2 with a linear range of 0.6-65 ng/mL .
★
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp142912-10μg
—
3 Em stock
51,98€
50μg
rp142912-50μg
—
3 Em stock
121,40€
500μg
rp142912-500μg
Sob encomenda · 8–12 semanas
25,95€
100μg
rp142912-100μg
—
2 Em stock
194,29€
1mg
rp142912-1mg
Sob encomenda · 8–12 semanas
983,93€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Apolipoprotein E3 Protein, >95%(SDS-PAGE)
Sinónimos
Apo-E | AD2 | Apo-E | ApoE4 | apolipoprotein E | Apolipoprotein E3 | LDLCQ5 | LPG
Grau
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Especificações e pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE)
Mecanismos bioquímicos e fisiológicos
ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in choleste
Pureza
>95%(SDS-PAGE)
Bioatividade
Immobilized Human ApoE at 5μg/mL (100 μL/well) can bind Human TREM2 with a linear range of 0.6-65 ng/mL .
Concentração de endotoxina
<1.0 EU/μg
Sistema de expressão
HEK293
Espécies
Human
Aminoácidos
19-317 aa
Sequência
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHHHHHHH
Etiqueta de proteína
His
Número de acesso
Peso molecular previsto
35.1 kDa
SDS-PAGE
36-38 kDa, under reducing conditions
Tipo de molécula
Protein
Armazenamento e envio
Forma
Lyophilized
Reconstituição
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condições de armazenamento de armazenamento
Store at -20°C,Avoid repeated freezing and thawing
Enviado em
Ice chest + Ice pads
Estabilidade e armazenamento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Imagens

Recombinant Human Apolipoprotein E3 Protein (rp142912) - SDS-PAGE
2 μg/lane of Recombinant Human Apolipoprotein E3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 36 kDa under reducing conditions and 30 - 36 & 80 kDa under non-reducing conditions.
APOE exists as multiple glycosylated and sialylated glycoforms within cells and in plasma (PubMed:29516132). The protein has a calculated MW of 35 kDa. The protein migrates as 30 - 36 kDa under reducing (R) condition due to glycosylation.


Recombinant Human Apolipoprotein E3 Protein (rp142912) - Binding Activity
Immobilized Recombinant Human Apolipoprotein E3 Protein (rp142912) at 5 μg/mL can bind Recombinant Human TREM2 Protein with the EC₅₀ of 71.16 ng/mL.


Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ25F0825636Certificate of AnalysisJun 22, 2026 rp142912
ZJ25F0825637Certificate of AnalysisJun 22, 2026 rp142912
ZJ25F0825638Certificate of AnalysisJun 22, 2026 rp142912
FAQs e artigos
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Perguntas frequentes

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.