Recombinant Human CD16 Protein, >95% (SDS-PAGE)

Cat. No.: rp143817
Disponível para encomenda
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P08637
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD16 Protein (rp143817) at 4 μg/mL can bind Human IgG1, the ED50 for this effect is 881.0 ng/mL.
★
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp143817-10μg
Sob encomenda · 8–12 semanas
104,04€
50μg
rp143817-50μg
Sob encomenda · 8–12 semanas
310,56€
100μg
rp143817-100μg
Sob encomenda · 8–12 semanas
440,72€
1mg
rp143817-1mg
Sob encomenda · 8–12 semanas
2262,98€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -80°C,Avoid repeated freezing and thawing Ships Dry ice packs + Cold packs Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Visão geral

Purity

≥ 95% SDS-PAGE.


Additional sequence information

Extracellular domain.


Function

Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.


Post-translational

Glycosylated. Contains high mannose- and complex-type oligosaccharides. The soluble form is produced by a proteolytic cleavage.


Specifications

Product Name
Recombinant Human CD16 Protein, >95% (SDS-PAGE)
Sinónimos
CD16a antigen; CD16a; CD16FCRIIIA; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc gamma receptor III-A; Fc gamma RIIIA; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb
Grau
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag
Especificações e pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Bioatividade
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD16 Protein (rp143817) at 4 μg/mL can bind Human IgG1, the ED50 for this effect is 881.0 ng/mL.
Concentração de endotoxina
<0.1 EU/μg
Sistema de expressão
HEK293
Espécies
Human
Aminoácidos
17-208 aa
Sequência
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH
Etiqueta de proteína
C-His
Número de acesso
Peso molecular previsto
22 kDa
SDS-PAGE
40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Armazenamento e envio
Forma
lyophilized
Condições de armazenamento de armazenamento
Store at -80°C,Avoid repeated freezing and thawing
Enviado em
Dry ice packs + Cold packs
Estabilidade e armazenamento
Upon delivery aliquot, Store at -80°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution.
Imagens

Recombinant Human CD16 Protein (rp143817) - Protein Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD16 Protein (rp143817) at 4 μg/mL can bind Human IgG1, the ED50 for this effect is 881.0 ng/mL.

Recombinant Human CD16 Protein (rp143817) - SDS-PAGE
2 μg/lane of Recombinant Human CD16 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 40 - 50 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ25F0521752Certificate of AnalysisMar 16, 2026 rp143817
ZJ25F0521753Certificate of AnalysisMar 16, 2026 rp143817
ZJ25F0521754Certificate of AnalysisMar 16, 2026 rp143817
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Perguntas frequentes

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?80 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships frozen with dry ice and cold packs. Unpack on arrival and transfer it to the storage condition stated above; handle dry ice with insulated gloves in a ventilated area.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.