Recombinant Human CD276 Protein, >95% (SDS-PAGE)

Cat. No.: rp143912
Disponível para encomenda
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
Q5ZPR3-2
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
1、Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL. 2、Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear range of 1 - 4 ng/mL (EC50:4.3 ng/mL).
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp143912-10μg
Em stock ≥10
121,40€
50μg
rp143912-50μg
8 Em stock
320,98€
100μg
rp143912-100μg
3 Em stock
511,88€
1mg
rp143912-1mg
Sob encomenda · 8–12 semanas
3123,77€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -80°C,Avoid repeated freezing and thawing Ships Dry ice packs + Cold packs Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Visão geral

Purity
>95% SDS-PAGE

Function
May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.

Specifications

Product Name
Recombinant Human CD276 Protein, >95% (SDS-PAGE)
Sinónimos
B7H3 | B7-H3 | B7H34Ig-B7-H3 | B7-H3B7 homolog 3 | CD276 antigen | CD276 molecule | CD276 | Costimulatory molecule | B7RP-2 | 4Ig-B7-H3
Grau
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag
Especificações e pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Bioatividade
1、Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL. 2、Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear range of 1 - 4 ng/mL (EC50:4.3 ng/mL).
Concentração de endotoxina
<0.1 EU/μg
Sistema de expressão
HEK293
Espécies
Human
Aminoácidos
29-246 aa
Sequência
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHH
Etiqueta de proteína
C-His
Número de acesso
Peso molecular previsto
23 kDa
SDS-PAGE
38.9 kDa, under reducing conditions; 37.0 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Armazenamento e envio
Forma
Lyophilized
Reconstituição
Reconstitute in sterile H2O to a concentration of 0.1-0.5 mg/ml.
Condições de armazenamento de armazenamento
Store at -80°C,Avoid repeated freezing and thawing
Enviado em
Dry ice packs + Cold packs
Estabilidade e armazenamento
Store at ﹣20~﹣80℃ for more than 1 year.
Imagens

Recombinant Human CD276 Protein (rp143912) - Protein Bioactivity
Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL.

Recombinant Human CD276 Protein (rp143912) - Protein Bioactivity
Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear range of 1 - 4 ng/mL (EC₅₀:4.3 ng/mL).

Recombinant Human CD276 Protein (rp143912) - SDS-PAGE
3 μg/lane of Recombinant Human CD276 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.9 kDa under reducing conditions and 37.0 kDa under non-reducing conditions.

Recombinant Human CD276 Protein (rp143912) - ELISA
Immobilized Recombinant Human CD276 Protein ( rp143912) at 1.0 μg/mL can bind Mirzotamab (anti-CD276) (Ab182952) with the EC₅₀ of 28.84 ng/mL.​

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ23F1201891Certificate of AnalysisApr 13, 2026 rp143912
ZJ23F1201892Certificate of AnalysisApr 13, 2026 rp143912
ZJ23F1201893Certificate of AnalysisApr 13, 2026 rp143912
FAQs e artigos
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.