Proteína C3a do Componente do Complemento Humano Recombinante

Cat. No.: rp183573

GRAU & PUREZA Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Accession #

P01024

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Especificações

Product Name

Proteína C3a do Componente do Complemento Humano Recombinante

Sinónimos

AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | Anaphylatoxin | Complement Component C3a

Grau

Carrier Free, PBS Only

Especificações e pureza

Sem transportador, ≥95%(SDS-PAGE)

Mecanismos bioquímicos e fisiológicos

O C3a é um polipéptido de anafilotoxina que compreende os aminoácidos (aa) 672-748 da proteína precursora do complemento C3. As anafilatoxinas são geradas proteoliticamente a partir das cadeias alfa C3, C4 e C5 por convertases formadas por outros fragment

Bioatividade

Testing in progress

Concentração de endotoxina

<1.0 EU/μg

Aminoácidos

672-748 aa

Sequência

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Número de acesso

P01024

Peso molecular previsto

9.1 kDa

SDS-PAGE

10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.

Tipo de molécula

Protein

Product Line

Produtos biológicos

Armazenamento e envio

Reconstituição

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condições de armazenamento de armazenamento

Conservar a -20°C. Evitar a congelação e descongelação repetidas

Enviado em

Arca de gelo + almofadas de gelo

Estabilidade e armazenamento

Armazenar a -20°C durante 1 ano. Evitar o ciclo de congelação/descongelação.

Imagens

SDS-PAGE: Recombinant Human Complement Component C3a Protein (rp183573)

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Alvos associados (humanos)

C3 Tclin Complement C3 (0 Activities)

Discover Target: C3

Activity Type	Activity Value -log(M)	Mechanism of Action	Activity Reference	Publications (PubMed IDs)

Perguntas frequentes

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does PBS Only mean?

PBS Only is a defined analytical purity tier suitable for workflows requiring a specific validated property. It specifies a minimum assay percentage, controlled limits on common impurities (water, heavy metals, residue on ignition), and lot-to-lot consistency. PBS Only is one of several purity tiers — choose based on the sensitivity and regulatory requirements of your method.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.