Recombinant Human ERMAP Protein

Cat. No.: rp188317
Disponível para encomenda
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
Q96PL5
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
★
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp188317-10μg
—
3 Em stock
78,01€
50μg
rp188317-50μg
—
3 Em stock
234,20€
100μg
rp188317-100μg
—
3 Em stock
373,04€
1mg
rp188317-1mg
Sob encomenda · 8–12 semanas
2256,03€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His Tag,PBS Only,≥95%(SDS-PAGE),See COA Animal Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human ERMAP Protein
Sinónimos
ERMAP | erythroblast membrane-associated protein (RD and SC blood groups) | erythroblast membrane-associated protein (Scianna blood group) | erythroblast membrane-associated protein | erythroid membrane-associated protein | hERMAP | MGC118810 | MGC118811
Grau
Animal Free, Carrier Free, His Tag, PBS Only
Especificações e pureza
Animal Free,Carrier Free,His Tag,PBS Only,≥95%(SDS-PAGE),See COA
Mecanismos bioquímicos e fisiológicos
Erythroid membrane-associated protein (ERMAP), also called Scianna blood group antigen, is a member of the butrophilin (BTN) and butrophilin-like (BTNL) family within the immunoglobulin superfamily. ERMAP consists of an extracellular domain (ECD) with one
Bioatividade
Testing in progress
Concentração de endotoxina
<1.0 EU/μg
Aminoácidos
1-155 aa
Sequência
MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAHHHHHH
Número de acesso
Peso molecular previsto
14.5 kDa
SDS-PAGE
15.0 kDa, under reducing conditions; 15.2 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Armazenamento e envio
Concentração
See COA
Reconstituição
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condições de armazenamento de armazenamento
Store at -20°C,Avoid repeated freezing and thawing
Enviado em
Ice chest + Ice pads
Estabilidade e armazenamento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imagens

Recombinant Human ERMAP Protein (rp188317) - SDS-PAGE
3 μg/lane of Recombinant Human ERMAP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.0 kDa under reducing conditions and 15.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ25F0926719Certificate of AnalysisJul 10, 2026 rp188317
ZJ25F0926720Certificate of AnalysisJul 10, 2026 rp188317
ZJ25F0926721Certificate of AnalysisJul 10, 2026 rp188317
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Perguntas frequentes

How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.