Recombinant Human Profilin 1 Protein, >95% (SDS-PAGE)

Cat. No.: rp183752
Disponível para encomenda
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P07737
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp183752-10μg
Em stock ≥10
69,33€
100μg
rp183752-100μg
Em stock ≥10
294,94€
1mg
rp183752-1mg
Sob encomenda · 8–12 semanas
1908,94€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His-Tag,≥95%(SDS-PAGE) Azide Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Visão geral

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR.

Specifications

Product Name
Recombinant Human Profilin 1 Protein, >95% (SDS-PAGE)
Sinónimos
Actin binding protein | ALS18 | Epididymis tissue protein Li 184a | OTTHUMP00000125244 | Pfn | PFN 1 | PFN1 | PROF1_HUMAN | Profilin I | Profilin-1 | Profilin1 | ProfilinI
Grau
Azide Free, Carrier Free, His Tag
Especificações e pureza
Carrier Free,Azide Free,His-Tag,≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Concentração de endotoxina
<1.0 EU/μg
Sistema de expressão
E. coli
Aminoácidos
2-140 aa
Sequência
MHHHHHHAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Etiqueta de proteína
N-His
Número de acesso
Peso molecular previsto
15.9 kDa
SDS-PAGE
13.8 kDa, under reducing conditions; 13.8 kDa, under non-reducing conditions
Tipo de molécula
Protein
Armazenamento e envio
Forma
Lyophilized
Reconstituição
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condições de armazenamento de armazenamento
Store at -20°C,Avoid repeated freezing and thawing
Enviado em
Ice chest + Ice pads
Estabilidade e armazenamento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imagens

Recombinant Human Profilin 1 Protein (rp183752) - SDS-PAGE
2 μg/lane of Recombinant Human Profilin 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ24F0505381Certificate of AnalysisSep 10, 2026 rp183752
ZJ24F0505382Certificate of AnalysisSep 10, 2026 rp183752
ZJ24F0505383Certificate of AnalysisSep 10, 2026 rp183752
FAQs e artigos
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Azide Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.