Recombinant Human PTN Protein, >96% (SDS-PAGE&HPLC)

Cat. No.: rp150679
Disponível para encomenda
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥96%(SDS-PAGE&HPLC)
Accession #
P21246
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated with 100 µl/well of a solution of 5-10 µg/ml rHuPTN.
★
Size
Alemanha (EU)
USA*
Price
Qty
10μg
rp150679-10μg
—
3 Em stock
124,87€
50μg
rp150679-50μg
—
1 Em stock
359,16€
100μg
rp150679-100μg
—
1 Em stock
694,10€
1mg
rp150679-1mg
Sob encomenda · 8–12 semanas
4564,22€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,PBS Only,≥96%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Visão geral

Purity
>96% (SDS-PAGE&HPLC)
Function
Heparin binding mitogenic protein. Has neurite extension activity.

Specifications

Product Name
Recombinant Human PTN Protein, >96% (SDS-PAGE&HPLC)
Sinónimos
HARP | HBBM | HB-GAM | HBGF8 | HBNF | HBNF1 | HBNF-1 | Heparin-binding brain mitogen | HNGF-8 | NEGF1HBGF-8 | neurite growth-promoting factor 1 | neurite growth-promoting factor1) | OSF-1 | Osteoblast-specific factor 1 | Pleiotrophin | PTN | HBGAM | hepar
Grau
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, PBS Only
Especificações e pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,PBS Only,≥96%(SDS-PAGE&HPLC)
Pureza
>96% (SDS-PAGE&HPLC)
Bioatividade
Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated with 100 µl/well of a solution of 5-10 µg/ml rHuPTN.
Concentração de endotoxina
<0.1 EU/μg
Sistema de expressão
E.coli
Espécies
Human
Aminoácidos
33-168 aa
Sequência
GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Etiqueta de proteína
No tag
Número de acesso
Peso molecular previsto
15.3 kDa
SDS-PAGE
15.3 kDa
Tipo de molécula
Protein
Armazenamento e envio
Forma
Lyophilized
Reconstituição
It is recommended that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condições de armazenamento de armazenamento
Store at -20°C,Avoid repeated freezing and thawing
Enviado em
Ice chest + Ice pads
Estabilidade e armazenamento
Store at -20 ℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imagens

Recombinant Human PTN Protein (rp150679) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated with 100 µL/well of a solution of 5-10 µg/mL PTN.

Recombinant Human PTN Protein (rp150679) - SDS-PAGE
Recombinant Human PTN Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados(CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataItem
ZJ23F0800866Certificate of AnalysisJun 25, 2024 rp150679
ZJ23F0800868Certificate of AnalysisJun 25, 2024 rp150679
ZJ23F0800867Certificate of AnalysisAug 23, 2023 rp150679
FAQs e artigos
Calculadoras de soluções
Revisões

Avaliações dos Clientes

Perguntas frequentes

What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.