🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

RAB24

DescriçãoRas-related protein Rab-24

Gene and Protein Information

Gene ID53917
Uniprot Accession IDs Q969Q5 A0A024R7N9 Q7Z4Z7
Ensembl ID ENSP00000304376
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp471755RAB24RAB24, member RAS oncogene family9598VGNC:8633OMA, EggNOG
Macaque698876RAB24RAB24, member RAS oncogene family9544OMA, EggNOG
Mouse19336Rab24RAB24, member RAS oncogene family10090MGI:105065Inparanoid, OMA, EggNOG
Dog479277RAB24RAB24, member RAS oncogene family9615VGNC:45264Inparanoid, OMA, EggNOG
Horse100058530RAB24RAB24, member RAS oncogene family9796VGNC:22097Inparanoid, OMA, EggNOG
Cow617635RAB24RAB24, member RAS oncogene family9913VGNC:33631Inparanoid, OMA, EggNOG
Pig100511865RAB24RAB24, member RAS oncogene family9823Inparanoid, OMA, EggNOG
Opossum100027665RAB24RAB24, member RAS oncogene family13616Inparanoid, EggNOG
Chicken427627RAB24RAB24, member RAS oncogene family9031CGNC:2157Inparanoid, OMA, EggNOG
Anole lizard100563654rab24RAB24, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus548925rab24RAB24, member RAS oncogene family8364XB-GENE-491489Inparanoid, OMA, EggNOG
Zebrafish574423rab24RAB24, member RAS oncogene family7955ZDB-GENE-050706-110Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.