RAMP3

DescriçãoReceptor activity-modifying protein 3

Gene and Protein Information

Gene ID10268
Uniprot Accession IDs O60896 Q7Z2Y1
Ensembl ID ENSP00000242249
FamilyBelongs to the RAMP family.
Sequence
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp739151RAMP3receptor activity modifying protein 39598VGNC:14081OMA, EggNOG
Mouse56089Ramp3receptor (calcitonin) activity modifying protein 310090MGI:1860292Inparanoid, OMA, EggNOG
Rat56820Ramp3receptor activity modifying protein 310116RGD:61873Inparanoid, OMA
Dog100855938RAMP3receptor activity modifying protein 39615VGNC:54348Inparanoid, OMA, EggNOG
HorseRAMP3receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845]9796OMA, EggNOG
Cow613547RAMP3receptor activity modifying protein 39913VGNC:33708Inparanoid, OMA, EggNOG
Opossum100030491RAMP3receptor activity modifying protein 313616Inparanoid, OMA, EggNOG
PlatypusRAMP3receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845]9258OMA, EggNOG
Anole lizard100555378ramp3receptor activity modifying protein 328377Inparanoid, OMA, EggNOG
Xenopusramp3receptor (G protein-coupled) activity modifying protein 3 [Source:Xenbase;Acc:XB-GENE-983292]8364OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.