🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

RAB8A

DescriçãoRas-related protein Rab-8A

Gene and Protein Information

Gene ID4218
Uniprot Accession IDs P61006 B4DEK7 P24407 Q6FHV5
Ensembl ID ENSP00000300935
Symbol MEL RAB8 MEL RAB8
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp468760RAB8ARAB8A, member RAS oncogene family9598VGNC:7571OMA, EggNOG
Macaque100423251RAB8ARAB8A, member RAS oncogene family9544Inparanoid, OMA, EggNOG
Mouse17274Rab8aRAB8A, member RAS oncogene family10090MGI:96960Inparanoid, OMA, EggNOG
Rat117103Rab8aRAB8A, member RAS oncogene family10116RGD:621144Inparanoid, OMA, EggNOG
Dog403773RAB8ARAB8A, member RAS oncogene family9615VGNC:45295Inparanoid, OMA
Horse100147248RAB8ARAB8A, member RAS oncogene family9796VGNC:22128Inparanoid, OMA
Cow100125881RAB8ARAB8A, member RAS oncogene family9913VGNC:33662Inparanoid, OMA
Pig100511006RAB8ARAB8A, member RAS oncogene family9823Inparanoid, OMA
Chicken428352RAB8ARAB8A, member RAS oncogene family9031CGNC:66558Inparanoid, OMA
Xenopus100125217rab8aRAB8A, member RAS oncogene family8364XB-GENE-1018135Inparanoid, OMA
Zebrafish571897rab8aRAB8A, member RAS oncogene family7955ZDB-GENE-070424-36Inparanoid, OMA
C. elegans171935rab-8RAB family6239Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.