🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

DUSP3

DescriçãoDual specificity protein phosphatase 3

Gene and Protein Information

Gene ID1845
Uniprot Accession IDs P51452 D3DX45 Q5U0J1 Q8IYJ9
Ensembl ID ENSP00000226004
Symbol VHR VHR
FamilyBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp468271DUSP3dual specificity phosphatase 39598VGNC:12093OMA, EggNOG
Macaque713686DUSP3dual specificity phosphatase 39544Inparanoid, OMA, EggNOG
Mouse72349Dusp3dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)10090MGI:1919599Inparanoid, OMA, EggNOG
Rat498003Dusp3dual specificity phosphatase 310116RGD:1560049Inparanoid, OMA, EggNOG
Dog480505DUSP3dual specificity phosphatase 39615VGNC:53236Inparanoid, OMA, EggNOG
Horse100064999DUSP3dual specificity phosphatase 39796VGNC:51807Inparanoid, OMA, EggNOG
Cow615432DUSP3dual specificity phosphatase 39913VGNC:28259Inparanoid, OMA, EggNOG
Pig100512983DUSP3dual specificity phosphatase 39823OMA, EggNOG
OpossumDUSP3dual specificity phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:3069]13616Inparanoid, OMA, EggNOG
Anole lizard100555344dusp3dual specificity phosphatase 328377Inparanoid, OMA, EggNOG
Zebrafish100000665dusp3adual specificity phosphatase 3a7955ZDB-GENE-111207-3OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.