🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

RALA

DescriçãoRas-related protein Ral-A

Gene and Protein Information

Gene ID5898
Uniprot Accession IDs P11233 A4D1W3
Ensembl ID ENSP00000005257
Symbol RAL RAL
FamilyBelongs to the small GTPase superfamily. Ras family.
Sequence
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp737424RALARAS like proto-oncogene A9598VGNC:10412OMA, EggNOG
Mouse56044Ralav-ral simian leukemia viral oncogene A (ras related)10090MGI:1927243Inparanoid, OMA, EggNOG
Rat81757RalaRAS like proto-oncogene A10116RGD:619851Inparanoid, OMA
Dog475875RALARAS like proto-oncogene A9615VGNC:45330Inparanoid, OMA, EggNOG
Horse100051360RALARAS like proto-oncogene A9796VGNC:22159Inparanoid, OMA, EggNOG
Cow538477RALARAS like proto-oncogene A9913VGNC:33698Inparanoid, OMA, EggNOG
Pig100622254RALARAS like proto-oncogene A9823OMA, EggNOG
Opossum100011023RALARAS like proto-oncogene A13616Inparanoid, OMA, EggNOG
Anole lizard100555475ralaRAS like proto-oncogene A28377Inparanoid, OMA, EggNOG
Xenopus548669ralav-ral simian leukemia viral oncogene homolog A (ras related)8364XB-GENE-485016Inparanoid, OMA, EggNOG
Zebrafish393993ralaav-ral simian leukemia viral oncogene homolog Aa (ras related)7955ZDB-GENE-040426-1344Inparanoid, OMA, EggNOG
C. elegans175433ral-1RAL (Ras-related GTPase) homolog6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related protein Ral-A
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related protein Ral-A

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.